BLASTX nr result
ID: Glycyrrhiza29_contig00019987
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00019987 (556 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003606465.1 hypothetical protein MTR_4g060630 [Medicago trunc... 77 9e-15 XP_003607872.1 hypothetical protein MTR_4g083930 [Medicago trunc... 54 1e-06 >XP_003606465.1 hypothetical protein MTR_4g060630 [Medicago truncatula] AES88662.1 hypothetical protein MTR_4g060630 [Medicago truncatula] Length = 129 Score = 76.6 bits (187), Expect = 9e-15 Identities = 32/61 (52%), Positives = 43/61 (70%) Frame = +3 Query: 168 ELGMAMGRVL*YSSTYPRFKKISIPRPILAWVATLIPLPLLFGYLSTHTRANYTHFNFEN 347 + GMAMGRVL S YP FKK+ +P P+ +W TL+ P+ +GYLS HTR +Y HFN+E Sbjct: 62 QCGMAMGRVLQCPSPYPHFKKLPVPVPVPSWETTLVSFPISYGYLSVHTRTHYPHFNYEK 121 Query: 348 S 350 + Sbjct: 122 T 122 >XP_003607872.1 hypothetical protein MTR_4g083930 [Medicago truncatula] AES90069.1 hypothetical protein MTR_4g083930 [Medicago truncatula] Length = 69 Score = 53.9 bits (128), Expect = 1e-06 Identities = 31/55 (56%), Positives = 33/55 (60%) Frame = -2 Query: 345 FQS*SACNWHGYGYLGTQKVRVRGSKLLPMRVWVWVWIFF*IAGMWTSTIVPYPL 181 F A N GYGYL T +V RG KLLP RV V IFF AGM T +VPYPL Sbjct: 8 FYGSGAGNGCGYGYLSTHRVWGRGLKLLPTRVRARVRIFFINAGMGTDIVVPYPL 62