BLASTX nr result
ID: Glycyrrhiza29_contig00019835
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00019835 (245 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019443576.1 PREDICTED: putative pentatricopeptide repeat-cont... 53 4e-06 >XP_019443576.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g03510 [Lupinus angustifolius] OIW11769.1 hypothetical protein TanjilG_14309 [Lupinus angustifolius] Length = 430 Score = 52.8 bits (125), Expect = 4e-06 Identities = 29/52 (55%), Positives = 31/52 (59%), Gaps = 1/52 (1%) Frame = +3 Query: 87 THTRLLSLTKLMCSHINQSRHDEA-XXXXXXXXXXXXXXDAHVFSLALKSCT 239 TH RLLS TKL+ SHIN SRHD+A D HVFSL LKSCT Sbjct: 8 THLRLLSFTKLISSHINHSRHDQALSVFHHIHSSLAISLDPHVFSLILKSCT 59