BLASTX nr result
ID: Glycyrrhiza29_contig00019760
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00019760 (548 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003629705.1 lipase/lipooxygenase, PLAT/LH2 family protein, pu... 63 2e-08 XP_003612889.2 hypothetical protein MTR_5g030170 [Medicago trunc... 59 6e-08 XP_001780322.1 predicted protein [Physcomitrella patens] EDQ5488... 59 5e-07 XP_003617924.1 transmembrane protein, putative [Medicago truncat... 54 6e-07 OMP06100.1 transcription factor bHLH30-like protein [Corchorus o... 52 2e-06 XP_003601190.1 hypothetical protein MTR_3g077010 [Medicago trunc... 52 2e-06 >XP_003629705.1 lipase/lipooxygenase, PLAT/LH2 family protein, putative [Medicago truncatula] AET04181.1 lipase/lipooxygenase, PLAT/LH2 family protein, putative [Medicago truncatula] Length = 488 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -1 Query: 467 FAFAGSRTRVYCLEGNYPNRWTTNA*CLCCFTFVMINVY 351 +AFAGSRTRVYCLEGNYPNRWTTNA CC +F +Y Sbjct: 3 YAFAGSRTRVYCLEGNYPNRWTTNA---CCSSFETERIY 38 >XP_003612889.2 hypothetical protein MTR_5g030170 [Medicago truncatula] AES95847.2 hypothetical protein MTR_5g030170 [Medicago truncatula] Length = 151 Score = 59.3 bits (142), Expect = 6e-08 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 482 ESKKTFAFAGSRTRVYCLEGNYPNRWTTNA 393 E K AFAGSRTRVYCLEGNYPNRWTTNA Sbjct: 120 EKIKKIAFAGSRTRVYCLEGNYPNRWTTNA 149 >XP_001780322.1 predicted protein [Physcomitrella patens] EDQ54881.1 predicted protein [Physcomitrella patens] Length = 382 Score = 58.9 bits (141), Expect = 5e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -1 Query: 479 SKKTFAFAGSRTRVYCLEGNYPNRWTTNA 393 S++T AFAGSRTRV+CLEGNYPNRWTTNA Sbjct: 25 SERTAAFAGSRTRVHCLEGNYPNRWTTNA 53 >XP_003617924.1 transmembrane protein, putative [Medicago truncatula] AET00883.1 transmembrane protein, putative [Medicago truncatula] Length = 60 Score = 54.3 bits (129), Expect = 6e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -2 Query: 466 LRLPGVEPGSIAWKAIILTVGLQTLDVCVASLLL 365 +RLPGVEPGSIAWKAIILTVGLQTL V L++ Sbjct: 1 MRLPGVEPGSIAWKAIILTVGLQTLACFVVCLII 34 >OMP06100.1 transcription factor bHLH30-like protein [Corchorus olitorius] Length = 35 Score = 52.4 bits (124), Expect = 2e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -2 Query: 466 LRLPGVEPGSIAWKAIILTVGLQTLDV 386 +RLPGVEPGSIAWKAIILTVGLQTL V Sbjct: 4 MRLPGVEPGSIAWKAIILTVGLQTLVV 30 >XP_003601190.1 hypothetical protein MTR_3g077010 [Medicago truncatula] AES71441.1 hypothetical protein MTR_3g077010 [Medicago truncatula] Length = 50 Score = 52.4 bits (124), Expect = 2e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = -2 Query: 466 LRLPGVEPGSIAWKAIILTVGLQTLDVCVA 377 +RLPGVEPGSIAWKAIILTVGLQTL VA Sbjct: 1 MRLPGVEPGSIAWKAIILTVGLQTLVDIVA 30