BLASTX nr result
ID: Glycyrrhiza29_contig00019739
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00019739 (281 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SFK54118.1 hypothetical protein SAMN04488125_102341 [Methylobact... 65 1e-11 WP_056247153.1 hypothetical protein [Methylobacterium sp. Leaf45... 58 7e-09 >SFK54118.1 hypothetical protein SAMN04488125_102341 [Methylobacterium salsuginis] Length = 98 Score = 64.7 bits (156), Expect = 1e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 183 MSRTGHRSAARNYLPESKLEDLAVRLRRLANHR 281 MSR GHR+AARNYLPESKLEDLA+RLRRLANHR Sbjct: 1 MSRPGHRTAARNYLPESKLEDLAIRLRRLANHR 33 >WP_056247153.1 hypothetical protein [Methylobacterium sp. Leaf456] KQT47683.1 hypothetical protein ASG52_10425 [Methylobacterium sp. Leaf456] Length = 102 Score = 57.8 bits (138), Expect = 7e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 183 MSRTGHRSAARNYLPESKLEDLAVRLRRLANHR 281 M R HR+AARNYLPES+LEDLA+RLRRLANHR Sbjct: 1 MPRPTHRTAARNYLPESRLEDLALRLRRLANHR 33