BLASTX nr result
ID: Glycyrrhiza29_contig00019625
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00019625 (206 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007161540.1 hypothetical protein PHAVU_001G077900g [Phaseolus... 61 2e-09 XP_004498559.1 PREDICTED: uncharacterized protein LOC101507506 [... 52 3e-06 >XP_007161540.1 hypothetical protein PHAVU_001G077900g [Phaseolus vulgaris] ESW33534.1 hypothetical protein PHAVU_001G077900g [Phaseolus vulgaris] Length = 310 Score = 61.2 bits (147), Expect = 2e-09 Identities = 32/61 (52%), Positives = 36/61 (59%) Frame = -3 Query: 183 QDQRGCLEQRPXXXXXXXXXXXXXXXEYLKDFLEERHKLKCAAKRRPKHIETPPKSLAKV 4 Q + CLE+RP EYLKDFLE R KLKC A+R PKH+ PPKSL KV Sbjct: 161 QKAKVCLEERPEDRDEEEPEDDDSEDEYLKDFLESRPKLKCIAERPPKHLVMPPKSLPKV 220 Query: 3 E 1 E Sbjct: 221 E 221 >XP_004498559.1 PREDICTED: uncharacterized protein LOC101507506 [Cicer arietinum] Length = 314 Score = 52.4 bits (124), Expect = 3e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 102 YLKDFLEERHKLKCAAKRRPKHIETPPKSLAKVE 1 YLKDFLE++ KLK AKRRPK+IE P KSLAKV+ Sbjct: 188 YLKDFLEKKSKLKSPAKRRPKNIEKPHKSLAKVD 221