BLASTX nr result
ID: Glycyrrhiza29_contig00018750
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00018750 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003626135.2 low temperature and salt responsive family protei... 79 2e-17 AFI47457.1 low temperature and salt responsive protein [Medicago... 78 3e-17 XP_003626132.1 low temperature and salt responsive family protei... 78 4e-17 XP_004494505.1 PREDICTED: hydrophobic protein LTI6B [Cicer ariet... 78 4e-17 AEJ20974.1 cold-inducible protein [Caragana jubata] 77 8e-17 XP_009366018.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus ... 77 1e-16 XP_008370335.1 PREDICTED: hydrophobic protein RCI2A [Malus domes... 77 1e-16 XP_015968732.1 PREDICTED: hydrophobic protein LTI6A-like [Arachi... 77 1e-16 GAU11401.1 hypothetical protein TSUD_343920 [Trifolium subterran... 76 2e-16 XP_009366021.1 PREDICTED: hydrophobic protein RCI2B [Pyrus x bre... 76 2e-16 XP_002884538.1 predicted protein [Arabidopsis lyrata subsp. lyra... 75 3e-16 KMZ61773.1 Low temperature and salt responsive protein [Zostera ... 75 5e-16 XP_009417776.1 PREDICTED: hydrophobic protein LTI6B [Musa acumin... 75 7e-16 AAQ84111.1 Clt1 [Citrus trifoliata] 75 7e-16 XP_009414164.1 PREDICTED: hydrophobic protein LTI6B-like [Musa a... 74 1e-15 AFK38849.1 unknown [Lotus japonicus] AFK49304.1 unknown [Lotus j... 74 1e-15 XP_017244642.1 PREDICTED: hydrophobic protein RCI2A [Daucus caro... 74 1e-15 XP_004494506.1 PREDICTED: hydrophobic protein LTI6B-like [Cicer ... 74 1e-15 ABK22915.1 unknown [Picea sitchensis] ABK25743.1 unknown [Picea ... 74 2e-15 CDX88232.1 BnaA06g28230D [Brassica napus] 74 2e-15 >XP_003626135.2 low temperature and salt responsive family protein [Medicago truncatula] ABD33207.2 Protein of unknown function UPF0057 [Medicago truncatula] AES82353.2 low temperature and salt responsive family protein [Medicago truncatula] Length = 54 Score = 78.6 bits (192), Expect = 2e-17 Identities = 35/50 (70%), Positives = 37/50 (74%) Frame = +2 Query: 161 MGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 310 MGTATC GVFLKFGCHVEFW+CLVLTL GYLPGI+YAIY Sbjct: 1 MGTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLFGYLPGILYAIY 50 >AFI47457.1 low temperature and salt responsive protein [Medicago sativa] Length = 54 Score = 78.2 bits (191), Expect = 3e-17 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = +2 Query: 161 MGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 313 MGTATC GVFLKFGC+VEFWICL+LT+LGYLPGI+YAIY+ Sbjct: 1 MGTATCVDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGILYAIYV 51 >XP_003626132.1 low temperature and salt responsive family protein [Medicago truncatula] ABD33197.1 Protein of unknown function UPF0057 [Medicago truncatula] AES82350.1 low temperature and salt responsive family protein [Medicago truncatula] AFK36815.1 unknown [Medicago truncatula] Length = 54 Score = 77.8 bits (190), Expect = 4e-17 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = +2 Query: 161 MGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 310 MGTATC GVFLKFGC+VEFWICL+LT+LGYLPGIIYAIY Sbjct: 1 MGTATCIDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAIY 50 >XP_004494505.1 PREDICTED: hydrophobic protein LTI6B [Cicer arietinum] Length = 54 Score = 77.8 bits (190), Expect = 4e-17 Identities = 35/50 (70%), Positives = 38/50 (76%) Frame = +2 Query: 161 MGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 310 MGTATC GVFLKFGC+VEFWICL+LT+LGYLPGIIYAIY Sbjct: 1 MGTATCVDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAIY 50 >AEJ20974.1 cold-inducible protein [Caragana jubata] Length = 54 Score = 77.0 bits (188), Expect = 8e-17 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +2 Query: 161 MGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 313 MGTATC GVFLKFGC+VEFWICLVLT+LGY+PGI+YA+Y+ Sbjct: 1 MGTATCIDIILAIILPPLGVFLKFGCNVEFWICLVLTILGYIPGILYALYV 51 >XP_009366018.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] XP_018505092.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] XP_018505094.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] Length = 54 Score = 76.6 bits (187), Expect = 1e-16 Identities = 35/50 (70%), Positives = 36/50 (72%) Frame = +2 Query: 161 MGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 310 MGTATC GVFL+FGCH EFWICLVLTL GYLPGIIYAIY Sbjct: 1 MGTATCVDIIIAILLPPLGVFLRFGCHSEFWICLVLTLFGYLPGIIYAIY 50 >XP_008370335.1 PREDICTED: hydrophobic protein RCI2A [Malus domestica] XP_008345581.1 PREDICTED: hydrophobic protein RCI2A [Malus domestica] Length = 54 Score = 76.6 bits (187), Expect = 1e-16 Identities = 35/50 (70%), Positives = 36/50 (72%) Frame = +2 Query: 161 MGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 310 MGTATC GVFL+FGCH EFWICLVLTL GYLPGIIYAIY Sbjct: 1 MGTATCIDIIIAILLPPLGVFLRFGCHSEFWICLVLTLFGYLPGIIYAIY 50 >XP_015968732.1 PREDICTED: hydrophobic protein LTI6A-like [Arachis duranensis] XP_016205642.1 PREDICTED: hydrophobic protein LTI6A-like [Arachis ipaensis] Length = 56 Score = 76.6 bits (187), Expect = 1e-16 Identities = 34/49 (69%), Positives = 36/49 (73%) Frame = +2 Query: 164 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 310 GTATC GVFLK+GCHVEFWICLVLTL GYLPGIIYA+Y Sbjct: 4 GTATCIDILLAIILPPLGVFLKYGCHVEFWICLVLTLFGYLPGIIYAVY 52 >GAU11401.1 hypothetical protein TSUD_343920 [Trifolium subterraneum] Length = 54 Score = 76.3 bits (186), Expect = 2e-16 Identities = 34/50 (68%), Positives = 37/50 (74%) Frame = +2 Query: 161 MGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 310 MGTATC GVFLKFGC VEFWICL+LT+LGYLPGI+YAIY Sbjct: 1 MGTATCIDIILAIILPPLGVFLKFGCKVEFWICLILTILGYLPGILYAIY 50 >XP_009366021.1 PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri] XP_009366022.1 PREDICTED: hydrophobic protein RCI2B [Pyrus x bretschneideri] Length = 54 Score = 75.9 bits (185), Expect = 2e-16 Identities = 33/51 (64%), Positives = 37/51 (72%) Frame = +2 Query: 161 MGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 313 MGTATC GVFL+FGCH EFWICLVLTL GY+PGI+YA+YI Sbjct: 1 MGTATCIDIILAILLPPLGVFLRFGCHSEFWICLVLTLFGYIPGILYALYI 51 >XP_002884538.1 predicted protein [Arabidopsis lyrata subsp. lyrata] EFH60797.1 predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 54 Score = 75.5 bits (184), Expect = 3e-16 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +2 Query: 161 MGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 313 MGTATC GVFL+FGC VEFWICLVLTLLGY+PGI+YA+Y+ Sbjct: 1 MGTATCVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGILYALYV 51 >KMZ61773.1 Low temperature and salt responsive protein [Zostera marina] Length = 54 Score = 75.1 bits (183), Expect = 5e-16 Identities = 33/50 (66%), Positives = 35/50 (70%) Frame = +2 Query: 161 MGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 310 MGT C GVFLKFGCHVEFWICL+LTL GYLPGIIYA+Y Sbjct: 1 MGTTNCIDILVAIFLPPIGVFLKFGCHVEFWICLLLTLFGYLPGIIYAVY 50 >XP_009417776.1 PREDICTED: hydrophobic protein LTI6B [Musa acuminata subsp. malaccensis] Length = 54 Score = 74.7 bits (182), Expect = 7e-16 Identities = 33/50 (66%), Positives = 37/50 (74%) Frame = +2 Query: 161 MGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 310 MGTATC GVFLKFGC VEFW+CL+LT+LGY+PGIIYAIY Sbjct: 1 MGTATCIDILVAIILPPLGVFLKFGCKVEFWLCLLLTILGYIPGIIYAIY 50 >AAQ84111.1 Clt1 [Citrus trifoliata] Length = 54 Score = 74.7 bits (182), Expect = 7e-16 Identities = 32/51 (62%), Positives = 37/51 (72%) Frame = +2 Query: 161 MGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 313 MGTATC GVFLKFGC EFWICL+LT+LGY+PGIIYA+Y+ Sbjct: 1 MGTATCVDIILAVILPPLGVFLKFGCKAEFWICLLLTILGYIPGIIYAVYV 51 >XP_009414164.1 PREDICTED: hydrophobic protein LTI6B-like [Musa acuminata subsp. malaccensis] Length = 54 Score = 74.3 bits (181), Expect = 1e-15 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = +2 Query: 161 MGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 310 MGTATC GVFLKFGC VEFW+CL+LT+LGY+PGIIYA+Y Sbjct: 1 MGTATCLDLLVAIILPPLGVFLKFGCKVEFWLCLLLTILGYIPGIIYAVY 50 >AFK38849.1 unknown [Lotus japonicus] AFK49304.1 unknown [Lotus japonicus] Length = 54 Score = 74.3 bits (181), Expect = 1e-15 Identities = 33/50 (66%), Positives = 37/50 (74%) Frame = +2 Query: 161 MGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 310 MGTATC GVFL+FGC VEFWICL+LT+LGY+PGIIYAIY Sbjct: 1 MGTATCVDIILAIILPPLGVFLRFGCKVEFWICLLLTILGYIPGIIYAIY 50 >XP_017244642.1 PREDICTED: hydrophobic protein RCI2A [Daucus carota subsp. sativus] KZM96817.1 hypothetical protein DCAR_015821 [Daucus carota subsp. sativus] Length = 56 Score = 74.3 bits (181), Expect = 1e-15 Identities = 34/52 (65%), Positives = 37/52 (71%) Frame = +2 Query: 158 KMGTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 313 K GTAT GVFLKFGCHVEFWICL+LT LGY+PGIIYAIY+ Sbjct: 2 KEGTATFIDIILAIILPPLGVFLKFGCHVEFWICLLLTFLGYIPGIIYAIYV 53 >XP_004494506.1 PREDICTED: hydrophobic protein LTI6B-like [Cicer arietinum] Length = 57 Score = 73.9 bits (180), Expect = 1e-15 Identities = 33/49 (67%), Positives = 34/49 (69%) Frame = +2 Query: 164 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 310 GTA C GVFLKFGCHVEFWICLVLT GY+PGIIYAIY Sbjct: 5 GTANCIDILLAILLPPLGVFLKFGCHVEFWICLVLTFFGYIPGIIYAIY 53 >ABK22915.1 unknown [Picea sitchensis] ABK25743.1 unknown [Picea sitchensis] ADM76850.1 low temprature induced-like protein [Picea sitchensis] ADM76851.1 low temprature induced-like protein [Picea sitchensis] ADM76852.1 low temprature induced-like protein [Picea sitchensis] ADM76853.1 low temprature induced-like protein [Picea sitchensis] ADM76854.1 low temprature induced-like protein [Picea sitchensis] ADM76855.1 low temprature induced-like protein [Picea sitchensis] ADM76856.1 low temprature induced-like protein [Picea sitchensis] ADM76857.1 low temprature induced-like protein [Picea sitchensis] ADM76858.1 low temprature induced-like protein [Picea sitchensis] ADM76859.1 low temprature induced-like protein [Picea sitchensis] ADM76860.1 low temprature induced-like protein [Picea sitchensis] ADM76861.1 low temprature induced-like protein [Picea sitchensis] ADM76862.1 low temprature induced-like protein [Picea sitchensis] ADM76863.1 low temprature induced-like protein [Picea sitchensis] ADM76864.1 low temprature induced-like protein [Picea sitchensis] ADM76865.1 low temprature induced-like protein [Picea sitchensis] ADM76866.1 low temprature induced-like protein [Picea sitchensis] ADM76867.1 low temprature induced-like protein [Picea sitchensis] ADM76868.1 low temprature induced-like protein [Picea sitchensis] ADM76869.1 low temprature induced-like protein [Picea sitchensis] ADM76870.1 low temprature induced-like protein [Picea sitchensis] ADM76871.1 low temprature induced-like protein [Picea sitchensis] ADM76872.1 low temprature induced-like protein [Picea sitchensis] ADM76873.1 low temprature induced-like protein [Picea sitchensis] ADM76874.1 low temprature induced-like protein [Picea sitchensis] ADM76875.1 low temprature induced-like protein [Picea sitchensis] ADM76876.1 low temprature induced-like protein [Picea sitchensis] ADM76877.1 low temprature induced-like protein [Picea sitchensis] ADM76878.1 low temprature induced-like protein [Picea sitchensis] ADM76879.1 low temprature induced-like protein [Picea sitchensis] ADM76880.1 low temprature induced-like protein [Picea sitchensis] ADM76881.1 low temprature induced-like protein [Picea sitchensis] ADM76882.1 low temprature induced-like protein [Picea sitchensis] ADM76883.1 low temprature induced-like protein [Picea sitchensis] ADM76884.1 low temprature induced-like protein [Picea sitchensis] ADM76885.1 low temprature induced-like protein [Picea sitchensis] ADM76886.1 low temprature induced-like protein [Picea sitchensis] ADM76887.1 low temprature induced-like protein [Picea sitchensis] ADM76888.1 low temprature induced-like protein [Picea sitchensis] ADM76889.1 low temprature induced-like protein [Picea sitchensis] ADM76890.1 low temprature induced-like protein [Picea sitchensis] ADM76891.1 low temprature induced-like protein [Picea sitchensis] ADM76892.1 low temprature induced-like protein [Picea sitchensis] ADM76893.1 low temprature induced-like protein [Picea sitchensis] ADM76894.1 low temprature induced-like protein [Picea sitchensis] ADM76895.1 low temprature induced-like protein [Picea sitchensis] Length = 59 Score = 73.9 bits (180), Expect = 2e-15 Identities = 32/49 (65%), Positives = 35/49 (71%) Frame = +2 Query: 164 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 310 GTA C GVFLKFGCH EFWICL+LT+LGYLPGI+YAIY Sbjct: 4 GTANCVDIILAIILPPVGVFLKFGCHAEFWICLLLTILGYLPGIVYAIY 52 >CDX88232.1 BnaA06g28230D [Brassica napus] Length = 62 Score = 73.9 bits (180), Expect = 2e-15 Identities = 33/49 (67%), Positives = 34/49 (69%) Frame = +2 Query: 164 GTATCXXXXXXXXXXXXGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 310 GTA C GVFLKFGCHVEFWICL LT LGY+PGIIYAIY Sbjct: 9 GTANCIDILLAILLPPLGVFLKFGCHVEFWICLALTFLGYIPGIIYAIY 57