BLASTX nr result
ID: Glycyrrhiza29_contig00018450
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00018450 (312 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN22579.1 hypothetical protein glysoja_037729 [Glycine soja] 79 4e-15 XP_003521506.1 PREDICTED: myosin-binding protein 7 [Glycine max]... 79 4e-15 KYP71156.1 hypothetical protein KK1_010400 [Cajanus cajan] 78 9e-15 XP_006604676.1 PREDICTED: myosin-binding protein 7-like [Glycine... 78 1e-14 XP_013450273.1 zein-binding protein [Medicago truncatula] KEH243... 77 2e-14 XP_007163013.1 hypothetical protein PHAVU_001G198800g [Phaseolus... 76 5e-14 XP_014494899.1 PREDICTED: myosin-binding protein 7-like [Vigna r... 72 1e-12 XP_004494287.1 PREDICTED: myosin-binding protein 7-like [Cicer a... 71 3e-12 XP_017416118.1 PREDICTED: myosin-binding protein 7-like [Vigna a... 71 4e-12 BAT86390.1 hypothetical protein VIGAN_04403400 [Vigna angularis ... 71 4e-12 XP_014623230.1 PREDICTED: myosin-binding protein 7 isoform X2 [G... 69 2e-11 GAU17549.1 hypothetical protein TSUD_340930 [Trifolium subterran... 69 2e-11 XP_003519024.1 PREDICTED: myosin-binding protein 7 isoform X1 [G... 69 2e-11 XP_014514323.1 PREDICTED: myosin-binding protein 7-like [Vigna r... 68 3e-11 XP_019453339.1 PREDICTED: myosin-binding protein 7-like [Lupinus... 67 6e-11 KRG96314.1 hypothetical protein GLYMA_19G202800 [Glycine max] KR... 67 6e-11 XP_019428922.1 PREDICTED: myosin-binding protein 7-like [Lupinus... 67 1e-10 XP_003537149.1 PREDICTED: myosin-binding protein 7-like [Glycine... 65 4e-10 XP_016184627.1 PREDICTED: myosin-binding protein 7-like [Arachis... 64 7e-10 XP_015951246.1 PREDICTED: myosin-binding protein 7-like [Arachis... 64 7e-10 >KHN22579.1 hypothetical protein glysoja_037729 [Glycine soja] Length = 468 Score = 79.3 bits (194), Expect = 4e-15 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 K+ HQIKYMFGLPSDS GLLMLLDKG HVRSWRYL STQ+GD Sbjct: 427 KKAHQIKYMFGLPSDSGGLLMLLDKGPHVRSWRYLQSTQVGD 468 >XP_003521506.1 PREDICTED: myosin-binding protein 7 [Glycine max] KRH68055.1 hypothetical protein GLYMA_03G205300 [Glycine max] Length = 468 Score = 79.3 bits (194), Expect = 4e-15 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 K+ HQIKYMFGLPSDS GLLMLLDKG HVRSWRYL STQ+GD Sbjct: 427 KKAHQIKYMFGLPSDSGGLLMLLDKGPHVRSWRYLQSTQVGD 468 >KYP71156.1 hypothetical protein KK1_010400 [Cajanus cajan] Length = 446 Score = 78.2 bits (191), Expect = 9e-15 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 KR H+IKYMFGLPSDS GLLMLLDKG HVRSWRYL TQ+GD Sbjct: 405 KRAHEIKYMFGLPSDSAGLLMLLDKGPHVRSWRYLQCTQVGD 446 >XP_006604676.1 PREDICTED: myosin-binding protein 7-like [Glycine max] KRG96312.1 hypothetical protein GLYMA_19G202800 [Glycine max] KRG96313.1 hypothetical protein GLYMA_19G202800 [Glycine max] Length = 468 Score = 77.8 bits (190), Expect = 1e-14 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 K+ HQIKYM GLPSDS GLLMLLDKG HVRSWRYL STQ+GD Sbjct: 427 KKAHQIKYMLGLPSDSAGLLMLLDKGPHVRSWRYLQSTQVGD 468 >XP_013450273.1 zein-binding protein [Medicago truncatula] KEH24301.1 zein-binding protein [Medicago truncatula] Length = 481 Score = 77.4 bits (189), Expect = 2e-14 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 KRGHQIKYMFGLPS + GLLMLLDKG HVRSWRY+S QLGD Sbjct: 440 KRGHQIKYMFGLPSSNAGLLMLLDKGPHVRSWRYVSRMQLGD 481 >XP_007163013.1 hypothetical protein PHAVU_001G198800g [Phaseolus vulgaris] ESW35007.1 hypothetical protein PHAVU_001G198800g [Phaseolus vulgaris] Length = 474 Score = 76.3 bits (186), Expect = 5e-14 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 K H+IKYMFGLPSDS GLLMLLDKG HVRSWRYL STQ+G+ Sbjct: 433 KEAHKIKYMFGLPSDSVGLLMLLDKGPHVRSWRYLQSTQVGE 474 >XP_014494899.1 PREDICTED: myosin-binding protein 7-like [Vigna radiata var. radiata] Length = 474 Score = 72.4 bits (176), Expect = 1e-12 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 K H+IKYMFGLPSDS GLLMLLDKG VRSWRY+ STQ+G+ Sbjct: 433 KEAHKIKYMFGLPSDSVGLLMLLDKGPRVRSWRYIQSTQVGE 474 >XP_004494287.1 PREDICTED: myosin-binding protein 7-like [Cicer arietinum] Length = 467 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQL 190 KRGHQIKYMFGLPS++ GLLMLLDKG VRSWRY+S TQ+ Sbjct: 428 KRGHQIKYMFGLPSNNNGLLMLLDKGPGVRSWRYISRTQM 467 >XP_017416118.1 PREDICTED: myosin-binding protein 7-like [Vigna angularis] KOM39546.1 hypothetical protein LR48_Vigan03g292800 [Vigna angularis] Length = 474 Score = 70.9 bits (172), Expect = 4e-12 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 K ++IKYMFGLPSDS GLLMLLDKG HVRSWRY+ TQ+G+ Sbjct: 433 KEANKIKYMFGLPSDSVGLLMLLDKGPHVRSWRYIQRTQVGE 474 >BAT86390.1 hypothetical protein VIGAN_04403400 [Vigna angularis var. angularis] Length = 476 Score = 70.9 bits (172), Expect = 4e-12 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 K ++IKYMFGLPSDS GLLMLLDKG HVRSWRY+ TQ+G+ Sbjct: 435 KEANKIKYMFGLPSDSVGLLMLLDKGPHVRSWRYIQRTQVGE 476 >XP_014623230.1 PREDICTED: myosin-binding protein 7 isoform X2 [Glycine max] KRH71750.1 hypothetical protein GLYMA_02G166500 [Glycine max] Length = 471 Score = 68.9 bits (167), Expect = 2e-11 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 KR HQ KYMFGLP +S GLLMLLDKG H R WR +SSTQ+GD Sbjct: 430 KRAHQSKYMFGLPPESVGLLMLLDKGMHARPWRCVSSTQVGD 471 >GAU17549.1 hypothetical protein TSUD_340930 [Trifolium subterraneum] Length = 476 Score = 68.9 bits (167), Expect = 2e-11 Identities = 31/42 (73%), Positives = 36/42 (85%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 KR QIKYMFGLPS S+G+LMLLDKG +VRSWRY+S QLG+ Sbjct: 435 KRSRQIKYMFGLPSSSSGMLMLLDKGPNVRSWRYVSRAQLGE 476 >XP_003519024.1 PREDICTED: myosin-binding protein 7 isoform X1 [Glycine max] KHN10376.1 hypothetical protein glysoja_048211 [Glycine soja] KRH71751.1 hypothetical protein GLYMA_02G166500 [Glycine max] Length = 490 Score = 68.9 bits (167), Expect = 2e-11 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 KR HQ KYMFGLP +S GLLMLLDKG H R WR +SSTQ+GD Sbjct: 449 KRAHQSKYMFGLPPESVGLLMLLDKGMHARPWRCVSSTQVGD 490 >XP_014514323.1 PREDICTED: myosin-binding protein 7-like [Vigna radiata var. radiata] Length = 487 Score = 68.2 bits (165), Expect = 3e-11 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 KR HQ KYMFGLP +S GLLMLLDKGT R WR +SSTQ+GD Sbjct: 446 KRAHQSKYMFGLPPESVGLLMLLDKGTRARPWRCVSSTQVGD 487 >XP_019453339.1 PREDICTED: myosin-binding protein 7-like [Lupinus angustifolius] XP_019453340.1 PREDICTED: myosin-binding protein 7-like [Lupinus angustifolius] Length = 490 Score = 67.4 bits (163), Expect = 6e-11 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 KR HQ KYMF LP+DS GLL+LLD GTH R WR +SSTQ+GD Sbjct: 449 KRAHQSKYMFELPADSMGLLLLLDNGTHARPWRCISSTQVGD 490 >KRG96314.1 hypothetical protein GLYMA_19G202800 [Glycine max] KRG96315.1 hypothetical protein GLYMA_19G202800 [Glycine max] Length = 493 Score = 67.4 bits (163), Expect = 6e-11 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -1 Query: 291 KYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 +YM GLPSDS GLLMLLDKG HVRSWRYL STQ+GD Sbjct: 458 RYMLGLPSDSAGLLMLLDKGPHVRSWRYLQSTQVGD 493 >XP_019428922.1 PREDICTED: myosin-binding protein 7-like [Lupinus angustifolius] Length = 478 Score = 66.6 bits (161), Expect = 1e-10 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 KR HQ KYMF LP+DS GLL+LLDKGT R WR +SSTQ+GD Sbjct: 437 KRAHQSKYMFDLPADSRGLLLLLDKGTRARPWRCISSTQVGD 478 >XP_003537149.1 PREDICTED: myosin-binding protein 7-like [Glycine max] KHN05748.1 hypothetical protein glysoja_040989 [Glycine soja] KRH32933.1 hypothetical protein GLYMA_10G087300 [Glycine max] Length = 490 Score = 65.1 bits (157), Expect = 4e-10 Identities = 30/42 (71%), Positives = 33/42 (78%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKGTHVRSWRYLSSTQLGD 184 KR HQ KYMFGLP +S GLLMLLDKGT R WR +SSTQ+ D Sbjct: 449 KRAHQSKYMFGLPLESVGLLMLLDKGTRARPWRCISSTQVWD 490 >XP_016184627.1 PREDICTED: myosin-binding protein 7-like [Arachis ipaensis] Length = 483 Score = 64.3 bits (155), Expect = 7e-10 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKG-THVRSWRYLSSTQLGD 184 KR HQ KY FGLP+DSTGLLMLLDKG TH R WR +S TQ+G+ Sbjct: 441 KRAHQSKYGFGLPADSTGLLMLLDKGITHTRPWRCISRTQVGN 483 >XP_015951246.1 PREDICTED: myosin-binding protein 7-like [Arachis duranensis] Length = 483 Score = 64.3 bits (155), Expect = 7e-10 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -1 Query: 309 KRGHQIKYMFGLPSDSTGLLMLLDKG-THVRSWRYLSSTQLGD 184 KR HQ KY FGLP+DSTGLLMLLDKG TH R WR +S TQ+G+ Sbjct: 441 KRAHQSKYGFGLPADSTGLLMLLDKGITHTRPWRCISRTQVGN 483