BLASTX nr result
ID: Glycyrrhiza29_contig00017916
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00017916 (222 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015961747.1 PREDICTED: metal transporter Nramp6-like [Arachis... 52 2e-06 XP_009387822.1 PREDICTED: metal transporter Nramp3 [Musa acumina... 52 4e-06 JAT55243.1 Metal transporter Nramp1 [Anthurium amnicola] 52 4e-06 AFI62059.1 metal transporter, partial [Moringa oleifera] 49 5e-06 XP_004486618.1 PREDICTED: metal transporter Nramp6 isoform X2 [C... 52 5e-06 XP_013465598.1 NRAMP metal ion transporter 6 [Medicago truncatul... 52 5e-06 XP_004486616.1 PREDICTED: metal transporter Nramp6 isoform X1 [C... 52 5e-06 XP_016174947.1 PREDICTED: metal transporter Nramp6-like [Arachis... 52 5e-06 XP_015933474.1 PREDICTED: metal transporter Nramp6-like [Arachis... 52 5e-06 XP_013465599.1 NRAMP metal ion transporter 6 [Medicago truncatul... 52 5e-06 KDO41581.1 hypothetical protein CISIN_1g008955mg [Citrus sinensis] 52 7e-06 KDO41580.1 hypothetical protein CISIN_1g008955mg [Citrus sinensis] 52 7e-06 KDO41579.1 hypothetical protein CISIN_1g008955mg [Citrus sinensis] 52 7e-06 OMO52859.1 Natural resistance-associated macrophage protein [Cor... 52 7e-06 XP_006368514.1 Metal transporter Nramp1 family protein [Populus ... 52 7e-06 XP_006493353.1 PREDICTED: metal transporter Nramp6 [Citrus sinen... 52 7e-06 XP_006427619.1 hypothetical protein CICLE_v10025318mg [Citrus cl... 52 7e-06 XP_007150803.1 hypothetical protein PHAVU_005G182000g [Phaseolus... 52 7e-06 KDO41576.1 hypothetical protein CISIN_1g008955mg [Citrus sinensis] 52 7e-06 OMO74194.1 Natural resistance-associated macrophage protein [Cor... 52 7e-06 >XP_015961747.1 PREDICTED: metal transporter Nramp6-like [Arachis duranensis] Length = 182 Score = 52.0 bits (123), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 125 AKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 AKEVLKG+FVP+LK GATGL ISL+GAMVM Sbjct: 136 AKEVLKGLFVPELKGSGATGLAISLLGAMVM 166 >XP_009387822.1 PREDICTED: metal transporter Nramp3 [Musa acuminata subsp. malaccensis] XP_009387823.1 PREDICTED: metal transporter Nramp3 [Musa acuminata subsp. malaccensis] XP_009387824.1 PREDICTED: metal transporter Nramp3 [Musa acuminata subsp. malaccensis] XP_009387825.1 PREDICTED: metal transporter Nramp3 [Musa acuminata subsp. malaccensis] XP_009387826.1 PREDICTED: metal transporter Nramp3 [Musa acuminata subsp. malaccensis] XP_018677440.1 PREDICTED: metal transporter Nramp3 [Musa acuminata subsp. malaccensis] Length = 543 Score = 52.4 bits (124), Expect = 4e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 122 KAKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 K+ EVLKG+FVPQLK GATGL ISL+GAMVM Sbjct: 208 KSSEVLKGLFVPQLKGNGATGLAISLLGAMVM 239 >JAT55243.1 Metal transporter Nramp1 [Anthurium amnicola] Length = 545 Score = 52.4 bits (124), Expect = 4e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 122 KAKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 K+ EVLKG+FVPQLK GATGL ISL+GAMVM Sbjct: 209 KSSEVLKGLFVPQLKGNGATGLAISLLGAMVM 240 >AFI62059.1 metal transporter, partial [Moringa oleifera] Length = 84 Score = 49.3 bits (116), Expect = 5e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +2 Query: 125 AKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 A EVL G+FVPQLK GATGL ISL+GAMVM Sbjct: 53 ASEVLHGLFVPQLKGNGATGLAISLLGAMVM 83 >XP_004486618.1 PREDICTED: metal transporter Nramp6 isoform X2 [Cicer arietinum] Length = 508 Score = 52.0 bits (123), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 125 AKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 AKEV+KG+FVPQLK GATGL ISL+GAMVM Sbjct: 216 AKEVVKGLFVPQLKGSGATGLAISLLGAMVM 246 >XP_013465598.1 NRAMP metal ion transporter 6 [Medicago truncatula] KEH39634.1 NRAMP metal ion transporter 6 [Medicago truncatula] Length = 545 Score = 52.0 bits (123), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 125 AKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 AKEV+KG+FVPQLK GATGL ISL+GAMVM Sbjct: 209 AKEVVKGLFVPQLKGSGATGLAISLLGAMVM 239 >XP_004486616.1 PREDICTED: metal transporter Nramp6 isoform X1 [Cicer arietinum] XP_004486617.1 PREDICTED: metal transporter Nramp6 isoform X1 [Cicer arietinum] Length = 552 Score = 52.0 bits (123), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 125 AKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 AKEV+KG+FVPQLK GATGL ISL+GAMVM Sbjct: 216 AKEVVKGLFVPQLKGSGATGLAISLLGAMVM 246 >XP_016174947.1 PREDICTED: metal transporter Nramp6-like [Arachis ipaensis] XP_016174948.1 PREDICTED: metal transporter Nramp6-like [Arachis ipaensis] Length = 555 Score = 52.0 bits (123), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 125 AKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 AKEVLKG+FVP+LK GATGL ISL+GAMVM Sbjct: 219 AKEVLKGLFVPELKGSGATGLAISLLGAMVM 249 >XP_015933474.1 PREDICTED: metal transporter Nramp6-like [Arachis duranensis] XP_015933475.1 PREDICTED: metal transporter Nramp6-like [Arachis duranensis] Length = 557 Score = 52.0 bits (123), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 125 AKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 AKEVLKG+FVP+LK GATGL ISL+GAMVM Sbjct: 221 AKEVLKGLFVPELKGSGATGLAISLLGAMVM 251 >XP_013465599.1 NRAMP metal ion transporter 6 [Medicago truncatula] KEH39635.1 NRAMP metal ion transporter 6 [Medicago truncatula] Length = 570 Score = 52.0 bits (123), Expect = 5e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 125 AKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 AKEV+KG+FVPQLK GATGL ISL+GAMVM Sbjct: 234 AKEVVKGLFVPQLKGSGATGLAISLLGAMVM 264 >KDO41581.1 hypothetical protein CISIN_1g008955mg [Citrus sinensis] Length = 394 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 122 KAKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 +AKEVL G+FVPQLK GATGL ISL+GAMVM Sbjct: 57 EAKEVLHGLFVPQLKGNGATGLAISLLGAMVM 88 >KDO41580.1 hypothetical protein CISIN_1g008955mg [Citrus sinensis] Length = 437 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 122 KAKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 +AKEVL G+FVPQLK GATGL ISL+GAMVM Sbjct: 206 EAKEVLHGLFVPQLKGNGATGLAISLLGAMVM 237 >KDO41579.1 hypothetical protein CISIN_1g008955mg [Citrus sinensis] Length = 511 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 122 KAKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 +AKEVL G+FVPQLK GATGL ISL+GAMVM Sbjct: 206 EAKEVLHGLFVPQLKGNGATGLAISLLGAMVM 237 >OMO52859.1 Natural resistance-associated macrophage protein [Corchorus capsularis] Length = 523 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +2 Query: 125 AKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 A EVLKG+FVPQLK GATGL ISL+GAMVM Sbjct: 206 ASEVLKGLFVPQLKGNGATGLAISLLGAMVM 236 >XP_006368514.1 Metal transporter Nramp1 family protein [Populus trichocarpa] ERP65083.1 Metal transporter Nramp1 family protein [Populus trichocarpa] Length = 541 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +2 Query: 125 AKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 AKEVLKG+FVPQLK GA GL ISL+GAMVM Sbjct: 206 AKEVLKGLFVPQLKGNGAAGLAISLLGAMVM 236 >XP_006493353.1 PREDICTED: metal transporter Nramp6 [Citrus sinensis] KDO41577.1 hypothetical protein CISIN_1g008955mg [Citrus sinensis] KDO41578.1 hypothetical protein CISIN_1g008955mg [Citrus sinensis] Length = 543 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 122 KAKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 +AKEVL G+FVPQLK GATGL ISL+GAMVM Sbjct: 206 EAKEVLHGLFVPQLKGNGATGLAISLLGAMVM 237 >XP_006427619.1 hypothetical protein CICLE_v10025318mg [Citrus clementina] ESR40859.1 hypothetical protein CICLE_v10025318mg [Citrus clementina] Length = 543 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 122 KAKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 +AKEVL G+FVPQLK GATGL ISL+GAMVM Sbjct: 206 EAKEVLHGLFVPQLKGNGATGLAISLLGAMVM 237 >XP_007150803.1 hypothetical protein PHAVU_005G182000g [Phaseolus vulgaris] XP_007150804.1 hypothetical protein PHAVU_005G182000g [Phaseolus vulgaris] ESW22797.1 hypothetical protein PHAVU_005G182000g [Phaseolus vulgaris] ESW22798.1 hypothetical protein PHAVU_005G182000g [Phaseolus vulgaris] Length = 544 Score = 51.6 bits (122), Expect = 7e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +2 Query: 125 AKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 AKEV+KG+FVP+LK GATGL ISL+GAMVM Sbjct: 208 AKEVIKGLFVPELKGNGATGLAISLLGAMVM 238 >KDO41576.1 hypothetical protein CISIN_1g008955mg [Citrus sinensis] Length = 547 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 122 KAKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 +AKEVL G+FVPQLK GATGL ISL+GAMVM Sbjct: 206 EAKEVLHGLFVPQLKGNGATGLAISLLGAMVM 237 >OMO74194.1 Natural resistance-associated macrophage protein [Corchorus olitorius] Length = 567 Score = 51.6 bits (122), Expect = 7e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +2 Query: 125 AKEVLKGIFVPQLKRRGATGLTISLIGAMVM 217 A EVLKG+FVPQLK GATGL ISL+GAMVM Sbjct: 206 ASEVLKGLFVPQLKGNGATGLAISLLGAMVM 236