BLASTX nr result
ID: Glycyrrhiza29_contig00017529
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00017529 (443 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003615676.1 ubiquinol oxidase 1a [Medicago truncatula] AES986... 62 1e-08 AGQ42776.1 mitochondrial alternative oxidase 2d1 [Medicago sativa] 61 3e-08 GAU27766.1 hypothetical protein TSUD_215770 [Trifolium subterran... 60 5e-08 XP_003615664.2 ubiquinol oxidase 1a [Medicago truncatula] AES986... 60 7e-08 >XP_003615676.1 ubiquinol oxidase 1a [Medicago truncatula] AES98634.1 ubiquinol oxidase 1a [Medicago truncatula] Length = 324 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = -2 Query: 139 LFRDCRNYHRHFSTAAILEPRHGGSGACGTGSFYWRRMSTLPETKD 2 LFR+ NYHR FSTA I++PRH G G+ YW+RMSTLPE KD Sbjct: 13 LFRNGGNYHRSFSTAVIVQPRHHQHGGGACGNLYWQRMSTLPEKKD 58 >AGQ42776.1 mitochondrial alternative oxidase 2d1 [Medicago sativa] Length = 329 Score = 61.2 bits (147), Expect = 3e-08 Identities = 33/49 (67%), Positives = 36/49 (73%), Gaps = 3/49 (6%) Frame = -2 Query: 139 LFRDCRNYHRHFSTAAILEPR---HGGSGACGTGSFYWRRMSTLPETKD 2 LFR NYHR FSTA I++PR HGG GACG S YW+RMSTLPE KD Sbjct: 13 LFRSGGNYHRSFSTAVIVQPRQHQHGG-GACG--SLYWQRMSTLPEKKD 58 >GAU27766.1 hypothetical protein TSUD_215770 [Trifolium subterraneum] Length = 289 Score = 60.5 bits (145), Expect = 5e-08 Identities = 31/48 (64%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = -2 Query: 139 LFRDCRNYHRHFSTAAI--LEPRHGGSGACGTGSFYWRRMSTLPETKD 2 LF++ RNYHR+FSTAAI L +HGG GSFYW+RMSTLPE KD Sbjct: 13 LFQNSRNYHRNFSTAAITQLSHQHGGGAR---GSFYWQRMSTLPEKKD 57 >XP_003615664.2 ubiquinol oxidase 1a [Medicago truncatula] AES98622.2 ubiquinol oxidase 1a [Medicago truncatula] Length = 323 Score = 60.1 bits (144), Expect = 7e-08 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = -2 Query: 139 LFRDCRNYHRHFSTAAILEPRHGGSGACGTGSFYWRRMSTLPETKD 2 LF RNYH FSTA I++PRH G GSFYW++MSTLPE KD Sbjct: 13 LFHSSRNYHCSFSTAVIVQPRHQNGGGT-RGSFYWQKMSTLPEKKD 57