BLASTX nr result
ID: Glycyrrhiza29_contig00017427
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00017427 (248 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRG94933.1 hypothetical protein GLYMA_19G1190001, partial [Glyci... 89 7e-20 XP_003554059.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Glyci... 89 1e-19 XP_016489272.1 PREDICTED: NADH--cytochrome b5 reductase 1-like [... 88 3e-19 XP_009604806.1 PREDICTED: NADH--cytochrome b5 reductase 1 isofor... 88 3e-19 XP_017631057.1 PREDICTED: NADH--cytochrome b5 reductase 1-like [... 87 7e-19 XP_016671238.1 PREDICTED: NADH--cytochrome b5 reductase 1-like [... 87 7e-19 EOY10437.1 NADH:cytochrome B5 reductase 1 isoform 2 [Theobroma c... 86 8e-19 XP_019162701.1 PREDICTED: NADH--cytochrome b5 reductase 1 isofor... 87 9e-19 KYP63988.1 NADH-cytochrome b5 reductase 1 [Cajanus cajan] 87 9e-19 XP_015088783.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Solan... 87 9e-19 XP_006339205.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Solan... 87 9e-19 XP_004249368.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Solan... 87 9e-19 XP_009348261.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Pyrus... 86 1e-18 CDP17645.1 unnamed protein product [Coffea canephora] 86 1e-18 XP_016555068.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Capsi... 86 1e-18 XP_017977523.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Theob... 86 1e-18 EOY10436.1 NADH:cytochrome B5 reductase 1 isoform 1 [Theobroma c... 86 1e-18 KYP44316.1 NADH-cytochrome b5 reductase 1 [Cajanus cajan] 86 2e-18 XP_003520929.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Glyci... 86 2e-18 XP_016697761.1 PREDICTED: NADH--cytochrome b5 reductase 1-like [... 86 2e-18 >KRG94933.1 hypothetical protein GLYMA_19G1190001, partial [Glycine max] Length = 241 Score = 89.0 bits (219), Expect = 7e-20 Identities = 44/55 (80%), Positives = 45/55 (81%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPA DIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF Sbjct: 190 GEGFVSKEMIQT---HCPAPAQDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 241 >XP_003554059.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Glycine max] KHN34628.1 NADH-cytochrome b5 reductase 1 [Glycine soja] Length = 278 Score = 89.0 bits (219), Expect = 1e-19 Identities = 44/55 (80%), Positives = 45/55 (81%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPA DIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF Sbjct: 227 GEGFVSKEMIQT---HCPAPAQDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 278 >XP_016489272.1 PREDICTED: NADH--cytochrome b5 reductase 1-like [Nicotiana tabacum] XP_016489273.1 PREDICTED: NADH--cytochrome b5 reductase 1-like [Nicotiana tabacum] XP_016489274.1 PREDICTED: NADH--cytochrome b5 reductase 1-like [Nicotiana tabacum] XP_016489276.1 PREDICTED: NADH--cytochrome b5 reductase 1-like [Nicotiana tabacum] XP_016489277.1 PREDICTED: NADH--cytochrome b5 reductase 1-like [Nicotiana tabacum] Length = 278 Score = 87.8 bits (216), Expect = 3e-19 Identities = 44/55 (80%), Positives = 45/55 (81%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPA DIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF Sbjct: 227 GVGFVSEEMIQT---HCPAPAADIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 278 >XP_009604806.1 PREDICTED: NADH--cytochrome b5 reductase 1 isoform X1 [Nicotiana tomentosiformis] XP_009604812.1 PREDICTED: NADH--cytochrome b5 reductase 1 isoform X1 [Nicotiana tomentosiformis] XP_009604816.1 PREDICTED: NADH--cytochrome b5 reductase 1 isoform X1 [Nicotiana tomentosiformis] XP_009604820.1 PREDICTED: NADH--cytochrome b5 reductase 1 isoform X1 [Nicotiana tomentosiformis] XP_018627330.1 PREDICTED: NADH--cytochrome b5 reductase 1 isoform X1 [Nicotiana tomentosiformis] Length = 278 Score = 87.8 bits (216), Expect = 3e-19 Identities = 44/55 (80%), Positives = 45/55 (81%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPA DIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF Sbjct: 227 GVGFVSEEMIQT---HCPAPAADIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 278 >XP_017631057.1 PREDICTED: NADH--cytochrome b5 reductase 1-like [Gossypium arboreum] Length = 280 Score = 87.0 bits (214), Expect = 7e-19 Identities = 42/55 (76%), Positives = 45/55 (81%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPAPDIKILRCGPPPMNKAMA HL+ALGY+PEMQFQF Sbjct: 229 GVGFVSKEMIQT---HCPAPAPDIKILRCGPPPMNKAMAGHLDALGYSPEMQFQF 280 >XP_016671238.1 PREDICTED: NADH--cytochrome b5 reductase 1-like [Gossypium hirsutum] Length = 280 Score = 87.0 bits (214), Expect = 7e-19 Identities = 42/55 (76%), Positives = 45/55 (81%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPAPDIKILRCGPPPMNKAMA HL+ALGY+PEMQFQF Sbjct: 229 GVGFVSKEMIQT---HCPAPAPDIKILRCGPPPMNKAMAGHLDALGYSPEMQFQF 280 >EOY10437.1 NADH:cytochrome B5 reductase 1 isoform 2 [Theobroma cacao] Length = 250 Score = 86.3 bits (212), Expect = 8e-19 Identities = 41/55 (74%), Positives = 46/55 (83%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G G+ S +IQI H PAPAPDI+ILRCGPPPMNKAMA HL+ALGY+PEMQFQF Sbjct: 199 GVGYVSKEIIQI---HCPAPAPDIQILRCGPPPMNKAMAGHLDALGYSPEMQFQF 250 >XP_019162701.1 PREDICTED: NADH--cytochrome b5 reductase 1 isoform X1 [Ipomoea nil] XP_019162702.1 PREDICTED: NADH--cytochrome b5 reductase 1 isoform X1 [Ipomoea nil] Length = 278 Score = 86.7 bits (213), Expect = 9e-19 Identities = 41/55 (74%), Positives = 45/55 (81%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPAPD++ILRCGPPPMNKAMAAHLEA+GY PEMQFQF Sbjct: 227 GVGFVSKEMIQ---SHCPAPAPDVQILRCGPPPMNKAMAAHLEAIGYTPEMQFQF 278 >KYP63988.1 NADH-cytochrome b5 reductase 1 [Cajanus cajan] Length = 278 Score = 86.7 bits (213), Expect = 9e-19 Identities = 43/55 (78%), Positives = 45/55 (81%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPA DIKILRCGPPPMNKAMAAHLEA+GYAPEMQFQF Sbjct: 227 GVGFVSKEMIQT---HCPAPAHDIKILRCGPPPMNKAMAAHLEAIGYAPEMQFQF 278 >XP_015088783.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Solanum pennellii] XP_015088785.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Solanum pennellii] Length = 278 Score = 86.7 bits (213), Expect = 9e-19 Identities = 43/55 (78%), Positives = 45/55 (81%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPA DIKILRCGPPPMNKAMAAHLEALGY+PEMQFQF Sbjct: 227 GVGFVSKEMIQA---HCPAPADDIKILRCGPPPMNKAMAAHLEALGYSPEMQFQF 278 >XP_006339205.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Solanum tuberosum] XP_006339206.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Solanum tuberosum] Length = 278 Score = 86.7 bits (213), Expect = 9e-19 Identities = 43/55 (78%), Positives = 45/55 (81%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPA DIKILRCGPPPMNKAMAAHLEALGY+PEMQFQF Sbjct: 227 GVGFVSKEMIQT---HCPAPADDIKILRCGPPPMNKAMAAHLEALGYSPEMQFQF 278 >XP_004249368.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Solanum lycopersicum] XP_010312193.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Solanum lycopersicum] XP_010312194.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Solanum lycopersicum] Length = 278 Score = 86.7 bits (213), Expect = 9e-19 Identities = 43/55 (78%), Positives = 45/55 (81%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPA DIKILRCGPPPMNKAMAAHLEALGY+PEMQFQF Sbjct: 227 GVGFVSKEMIQA---HCPAPADDIKILRCGPPPMNKAMAAHLEALGYSPEMQFQF 278 >XP_009348261.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Pyrus x bretschneideri] Length = 277 Score = 86.3 bits (212), Expect = 1e-18 Identities = 43/55 (78%), Positives = 45/55 (81%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPA DI+ILRCGPPPMNKAMAAHLEALGYAPEMQFQF Sbjct: 226 GVGFVSKEMIQ---EHLPAPAHDIQILRCGPPPMNKAMAAHLEALGYAPEMQFQF 277 >CDP17645.1 unnamed protein product [Coffea canephora] Length = 277 Score = 86.3 bits (212), Expect = 1e-18 Identities = 42/55 (76%), Positives = 44/55 (80%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPA DIK+LRCGPPPMNKAMAAHLEALGY PEMQFQF Sbjct: 226 GVGFVSKEMIQ---EHCPAPASDIKVLRCGPPPMNKAMAAHLEALGYTPEMQFQF 277 >XP_016555068.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Capsicum annuum] XP_016555069.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Capsicum annuum] XP_016555070.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Capsicum annuum] XP_016555071.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Capsicum annuum] Length = 278 Score = 86.3 bits (212), Expect = 1e-18 Identities = 43/55 (78%), Positives = 45/55 (81%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPA DIKILRCGPPPMNKAMAAHLEALGY+PEMQFQF Sbjct: 227 GVGFVSKEMIQA---HCPAPANDIKILRCGPPPMNKAMAAHLEALGYSPEMQFQF 278 >XP_017977523.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Theobroma cacao] Length = 280 Score = 86.3 bits (212), Expect = 1e-18 Identities = 41/55 (74%), Positives = 46/55 (83%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G G+ S +IQI H PAPAPDI+ILRCGPPPMNKAMA HL+ALGY+PEMQFQF Sbjct: 229 GVGYVSEEIIQI---HCPAPAPDIQILRCGPPPMNKAMAGHLDALGYSPEMQFQF 280 >EOY10436.1 NADH:cytochrome B5 reductase 1 isoform 1 [Theobroma cacao] Length = 280 Score = 86.3 bits (212), Expect = 1e-18 Identities = 41/55 (74%), Positives = 46/55 (83%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G G+ S +IQI H PAPAPDI+ILRCGPPPMNKAMA HL+ALGY+PEMQFQF Sbjct: 229 GVGYVSKEIIQI---HCPAPAPDIQILRCGPPPMNKAMAGHLDALGYSPEMQFQF 280 >KYP44316.1 NADH-cytochrome b5 reductase 1 [Cajanus cajan] Length = 278 Score = 85.9 bits (211), Expect = 2e-18 Identities = 41/55 (74%), Positives = 45/55 (81%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPAPDIK+LRCGPPPMNKAMA HLEALGY+P+MQFQF Sbjct: 227 GVGFVSKEMIQT---HCPAPAPDIKMLRCGPPPMNKAMATHLEALGYSPQMQFQF 278 >XP_003520929.1 PREDICTED: NADH--cytochrome b5 reductase 1 [Glycine max] KHN42176.1 NADH-cytochrome b5 reductase 1 [Glycine soja] KRH64963.1 hypothetical protein GLYMA_03G006900 [Glycine max] Length = 278 Score = 85.9 bits (211), Expect = 2e-18 Identities = 43/55 (78%), Positives = 44/55 (80%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPA DIKILRCGPPPMNKAMAAHLEALGYA EMQFQF Sbjct: 227 GEGFVSKEMIQT---HCPAPAQDIKILRCGPPPMNKAMAAHLEALGYASEMQFQF 278 >XP_016697761.1 PREDICTED: NADH--cytochrome b5 reductase 1-like [Gossypium hirsutum] Length = 280 Score = 85.9 bits (211), Expect = 2e-18 Identities = 41/55 (74%), Positives = 45/55 (81%) Frame = -1 Query: 239 GNGFQSSPLIQIRRRHPPAPAPDIKILRCGPPPMNKAMAAHLEALGYAPEMQFQF 75 G GF S +IQ H PAPAPDIKILRCGPPPMNKAMA HL+ALGY+PE+QFQF Sbjct: 229 GAGFVSKEMIQT---HCPAPAPDIKILRCGPPPMNKAMAGHLDALGYSPEIQFQF 280