BLASTX nr result
ID: Glycyrrhiza29_contig00016967
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00016967 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU20132.1 hypothetical protein TSUD_351940 [Trifolium subterran... 54 4e-06 >GAU20132.1 hypothetical protein TSUD_351940 [Trifolium subterraneum] Length = 515 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = +2 Query: 212 EFNPTLSVLLYTCSYHMASAANRAGATNDALYKELWHACAG 334 E NP + + S H+++ ++RAGATNDALYKELWHACAG Sbjct: 10 ELNP---IRAHMASNHLSATSSRAGATNDALYKELWHACAG 47