BLASTX nr result
ID: Glycyrrhiza29_contig00016901
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00016901 (750 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN00817.1 hypothetical protein glysoja_000485 [Glycine soja] 54 6e-06 >KHN00817.1 hypothetical protein glysoja_000485 [Glycine soja] Length = 105 Score = 53.9 bits (128), Expect = 6e-06 Identities = 29/52 (55%), Positives = 32/52 (61%) Frame = -2 Query: 593 MVRTGTIIGDGGPHQAVGGDMVQGRVVLLRVSLKGMDTVLEQGPVLDPGMDM 438 MV+TGT GDG P A G MV R VL R + M VL+ GP LDPGMDM Sbjct: 1 MVQTGTTAGDGAPDPAPGTGMVPVRAVLQRALPEDMAMVLDPGPGLDPGMDM 52