BLASTX nr result
ID: Glycyrrhiza29_contig00016617
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00016617 (335 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009146634.1 PREDICTED: chaperone protein dnaJ 6-like [Brassic... 59 7e-08 XP_013586141.1 PREDICTED: chaperone protein dnaJ 6 [Brassica ole... 58 1e-07 XP_013731736.1 PREDICTED: chaperone protein dnaJ 6-like [Brassic... 58 1e-07 OAP02209.1 hypothetical protein AXX17_AT3G12200 [Arabidopsis tha... 57 2e-07 NP_187824.1 Chaperone DnaJ-domain superfamily protein [Arabidops... 57 2e-07 NP_001325582.1 Chaperone DnaJ-domain superfamily protein [Arabid... 57 2e-07 XP_018488649.1 PREDICTED: chaperone protein dnaJ 6-like [Raphanu... 57 2e-07 KFK38582.1 hypothetical protein AALP_AA3G132300 [Arabis alpina] 57 2e-07 JAU26388.1 Chaperone protein dnaJ 6, partial [Noccaea caerulescens] 56 3e-07 XP_013749964.1 PREDICTED: chaperone protein dnaJ 6-like [Brassic... 56 5e-07 CDY08446.1 BnaA05g26820D [Brassica napus] 56 5e-07 XP_006399167.1 hypothetical protein EUTSA_v10014343mg [Eutrema s... 56 5e-07 XP_006286850.1 hypothetical protein CARUB_v10003891mg [Capsella ... 56 5e-07 JAU98001.1 Chaperone protein dnaJ 6 [Noccaea caerulescens] 56 5e-07 JAU72421.1 Chaperone protein dnaJ 6 [Noccaea caerulescens] 56 5e-07 XP_006279167.1 hypothetical protein CARUB_v10007961mg [Capsella ... 56 5e-07 XP_010548038.1 PREDICTED: chaperone protein dnaJ 6-like isoform ... 56 5e-07 XP_010548037.1 PREDICTED: chaperone protein dnaJ 6-like isoform ... 56 5e-07 XP_010105326.1 Chaperone protein dnaJ 6 [Morus notabilis] EXC043... 56 5e-07 XP_010279016.1 PREDICTED: chaperone protein dnaJ 6-like [Nelumbo... 56 6e-07 >XP_009146634.1 PREDICTED: chaperone protein dnaJ 6-like [Brassica rapa] Length = 269 Score = 58.5 bits (140), Expect = 7e-08 Identities = 34/78 (43%), Positives = 42/78 (53%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAAVLWMDSEEPRCLKEFHVEQPNSQRAKSIV 215 ++ RLFCSMLC NPKLDSH+FKDI+DEAIAA E + K + K Sbjct: 136 KMSRLFCSMLCSNPKLDSHRFKDIIDEAIAA------GEVKATKAYKKWAKEISEIKPPT 189 Query: 216 SFGEHNNSGKKGMECRLF 269 S + KKG E L+ Sbjct: 190 SPRKTRRKAKKGAETDLY 207 >XP_013586141.1 PREDICTED: chaperone protein dnaJ 6 [Brassica oleracea var. oleracea] Length = 267 Score = 57.8 bits (138), Expect = 1e-07 Identities = 33/78 (42%), Positives = 42/78 (53%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAAVLWMDSEEPRCLKEFHVEQPNSQRAKSIV 215 ++ RLFCSMLC NPKLDSH+FKDI+DEAI A E + K ++ K Sbjct: 134 KMSRLFCSMLCSNPKLDSHRFKDIIDEAITA------GEVKATKAYNKWAKEISEIKPPT 187 Query: 216 SFGEHNNSGKKGMECRLF 269 S + KKG E L+ Sbjct: 188 SPRKTRRKAKKGAETDLY 205 >XP_013731736.1 PREDICTED: chaperone protein dnaJ 6-like [Brassica napus] CDY42134.1 BnaC05g40850D [Brassica napus] Length = 267 Score = 57.8 bits (138), Expect = 1e-07 Identities = 33/78 (42%), Positives = 42/78 (53%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAAVLWMDSEEPRCLKEFHVEQPNSQRAKSIV 215 ++ RLFCSMLC NPKLDSH+FKDI+DEAI A E + K ++ K Sbjct: 134 KMSRLFCSMLCSNPKLDSHRFKDIIDEAITA------GEVKATKAYNKWAKEISEIKPPT 187 Query: 216 SFGEHNNSGKKGMECRLF 269 S + KKG E L+ Sbjct: 188 SPRKTRRKAKKGAETDLY 205 >OAP02209.1 hypothetical protein AXX17_AT3G12200 [Arabidopsis thaliana] Length = 262 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC NPKLDSH+FKDI+DEAIAA Sbjct: 134 KMSRLFCSMLCSNPKLDSHRFKDIIDEAIAA 164 >NP_187824.1 Chaperone DnaJ-domain superfamily protein [Arabidopsis thaliana] AAG51071.1 DnaJ protein, putative; 5702-7336 [Arabidopsis thaliana] BAB01967.1 dnaJ protein-like [Arabidopsis thaliana] AAQ62420.1 At3g12170 [Arabidopsis thaliana] BAD43073.1 hypothetical protein [Arabidopsis thaliana] AEE75161.1 Chaperone DnaJ-domain superfamily protein [Arabidopsis thaliana] Length = 262 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC NPKLDSH+FKDI+DEAIAA Sbjct: 134 KMSRLFCSMLCSNPKLDSHRFKDIIDEAIAA 164 >NP_001325582.1 Chaperone DnaJ-domain superfamily protein [Arabidopsis thaliana] ANM63498.1 Chaperone DnaJ-domain superfamily protein [Arabidopsis thaliana] Length = 298 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC NPKLDSH+FKDI+DEAIAA Sbjct: 170 KMSRLFCSMLCSNPKLDSHRFKDIIDEAIAA 200 >XP_018488649.1 PREDICTED: chaperone protein dnaJ 6-like [Raphanus sativus] Length = 264 Score = 57.0 bits (136), Expect = 2e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 39 VQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 + RLFCSMLC NPKLDSH+FKDI+DEAIAA Sbjct: 132 MSRLFCSMLCSNPKLDSHRFKDIIDEAIAA 161 >KFK38582.1 hypothetical protein AALP_AA3G132300 [Arabis alpina] Length = 427 Score = 57.4 bits (137), Expect = 2e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC NPKLDSH+FKDI+DEAIAA Sbjct: 134 KMSRLFCSMLCSNPKLDSHRFKDIIDEAIAA 164 >JAU26388.1 Chaperone protein dnaJ 6, partial [Noccaea caerulescens] Length = 209 Score = 56.2 bits (134), Expect = 3e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC +PKLDSH+FKDILDEAIAA Sbjct: 79 KMNRLFCSMLCSDPKLDSHRFKDILDEAIAA 109 >XP_013749964.1 PREDICTED: chaperone protein dnaJ 6-like [Brassica napus] Length = 269 Score = 56.2 bits (134), Expect = 5e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC NPKLDSH+FKD++DEAIAA Sbjct: 136 KMSRLFCSMLCSNPKLDSHRFKDMIDEAIAA 166 >CDY08446.1 BnaA05g26820D [Brassica napus] Length = 269 Score = 56.2 bits (134), Expect = 5e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC NPKLDSH+FKD++DEAIAA Sbjct: 136 KMSRLFCSMLCSNPKLDSHRFKDMIDEAIAA 166 >XP_006399167.1 hypothetical protein EUTSA_v10014343mg [Eutrema salsugineum] ESQ40620.1 hypothetical protein EUTSA_v10014343mg [Eutrema salsugineum] Length = 277 Score = 56.2 bits (134), Expect = 5e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC +PKLDSH+FKDILDEAIAA Sbjct: 146 KMNRLFCSMLCSDPKLDSHRFKDILDEAIAA 176 >XP_006286850.1 hypothetical protein CARUB_v10003891mg [Capsella rubella] EOA19748.1 hypothetical protein CARUB_v10003891mg [Capsella rubella] Length = 279 Score = 56.2 bits (134), Expect = 5e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC +PKLDSH+FKDILDEAIAA Sbjct: 151 KMNRLFCSMLCSDPKLDSHRFKDILDEAIAA 181 >JAU98001.1 Chaperone protein dnaJ 6 [Noccaea caerulescens] Length = 280 Score = 56.2 bits (134), Expect = 5e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC +PKLDSH+FKDILDEAIAA Sbjct: 150 KMNRLFCSMLCSDPKLDSHRFKDILDEAIAA 180 >JAU72421.1 Chaperone protein dnaJ 6 [Noccaea caerulescens] Length = 280 Score = 56.2 bits (134), Expect = 5e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC +PKLDSH+FKDILDEAIAA Sbjct: 150 KMNRLFCSMLCSDPKLDSHRFKDILDEAIAA 180 >XP_006279167.1 hypothetical protein CARUB_v10007961mg [Capsella rubella] EOA12065.1 hypothetical protein CARUB_v10007961mg [Capsella rubella] Length = 280 Score = 56.2 bits (134), Expect = 5e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC +PKLDSH+FKDILDEAIAA Sbjct: 152 KMNRLFCSMLCSDPKLDSHRFKDILDEAIAA 182 >XP_010548038.1 PREDICTED: chaperone protein dnaJ 6-like isoform X2 [Tarenaya hassleriana] Length = 285 Score = 56.2 bits (134), Expect = 5e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC +PKLDSH+FKDILDEAIAA Sbjct: 156 KMNRLFCSMLCSDPKLDSHRFKDILDEAIAA 186 >XP_010548037.1 PREDICTED: chaperone protein dnaJ 6-like isoform X1 [Tarenaya hassleriana] Length = 287 Score = 56.2 bits (134), Expect = 5e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC +PKLDSH+FKDILDEAIAA Sbjct: 156 KMNRLFCSMLCSDPKLDSHRFKDILDEAIAA 186 >XP_010105326.1 Chaperone protein dnaJ 6 [Morus notabilis] EXC04347.1 Chaperone protein dnaJ 6 [Morus notabilis] Length = 293 Score = 56.2 bits (134), Expect = 5e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC +PKLDSH+FKDILDEAIAA Sbjct: 163 KMNRLFCSMLCSDPKLDSHRFKDILDEAIAA 193 >XP_010279016.1 PREDICTED: chaperone protein dnaJ 6-like [Nelumbo nucifera] Length = 327 Score = 56.2 bits (134), Expect = 6e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +3 Query: 36 EVQRLFCSMLCLNPKLDSHQFKDILDEAIAA 128 ++ RLFCSMLC +PKLDSH+FKDILDEAIAA Sbjct: 198 KMNRLFCSMLCSDPKLDSHRFKDILDEAIAA 228