BLASTX nr result
ID: Glycyrrhiza29_contig00015998
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00015998 (611 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM52776.1 hypothetical protein LR48_Vigan09g143500 [Vigna angul... 112 5e-25 XP_017436622.1 PREDICTED: auxin response factor 8 isoform X2 [Vi... 112 5e-25 XP_017436621.1 PREDICTED: auxin response factor 8 isoform X1 [Vi... 112 5e-25 XP_003553137.1 PREDICTED: auxin response factor 8-like [Glycine ... 112 5e-25 XP_014518561.1 PREDICTED: auxin response factor 8 isoform X2 [Vi... 112 5e-25 XP_014518560.1 PREDICTED: auxin response factor 8 isoform X1 [Vi... 112 5e-25 XP_007146949.1 hypothetical protein PHAVU_006G084200g [Phaseolus... 110 1e-24 XP_007146950.1 hypothetical protein PHAVU_006G084200g [Phaseolus... 110 1e-24 XP_006591281.1 PREDICTED: auxin response factor 8-like [Glycine ... 110 1e-24 GAU44115.1 hypothetical protein TSUD_124020 [Trifolium subterran... 106 2e-23 XP_012571326.1 PREDICTED: auxin response factor 8 [Cicer arietin... 106 3e-23 KYP76045.1 Auxin response factor 8 [Cajanus cajan] 106 4e-23 XP_014504678.1 PREDICTED: auxin response factor 8-like isoform X... 105 8e-23 XP_017430293.1 PREDICTED: LOW QUALITY PROTEIN: auxin response fa... 105 9e-23 XP_007141982.1 hypothetical protein PHAVU_008G242400g [Phaseolus... 105 9e-23 BAT81321.1 hypothetical protein VIGAN_03101200 [Vigna angularis ... 105 9e-23 XP_014504677.1 PREDICTED: auxin response factor 8-like isoform X... 105 9e-23 XP_004490754.1 PREDICTED: auxin response factor 8-like [Cicer ar... 105 1e-22 XP_003616115.1 auxin response factor 2 [Medicago truncatula] AES... 103 5e-22 XP_013460551.1 auxin response factor 2 [Medicago truncatula] KEH... 101 2e-21 >KOM52776.1 hypothetical protein LR48_Vigan09g143500 [Vigna angularis] Length = 825 Score = 112 bits (279), Expect = 5e-25 Identities = 54/60 (90%), Positives = 54/60 (90%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGEQAVES AL SGQRLNG GAES I SGPPSIGSLEY Sbjct: 766 WESFVNNVWYIKILSPEDIQKMGEQAVESLALGSGQRLNGTGAESQDIVSGPPSIGSLEY 825 >XP_017436622.1 PREDICTED: auxin response factor 8 isoform X2 [Vigna angularis] BAT88165.1 hypothetical protein VIGAN_05161100 [Vigna angularis var. angularis] Length = 838 Score = 112 bits (279), Expect = 5e-25 Identities = 54/60 (90%), Positives = 54/60 (90%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGEQAVES AL SGQRLNG GAES I SGPPSIGSLEY Sbjct: 779 WESFVNNVWYIKILSPEDIQKMGEQAVESLALGSGQRLNGTGAESQDIVSGPPSIGSLEY 838 >XP_017436621.1 PREDICTED: auxin response factor 8 isoform X1 [Vigna angularis] Length = 839 Score = 112 bits (279), Expect = 5e-25 Identities = 54/60 (90%), Positives = 54/60 (90%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGEQAVES AL SGQRLNG GAES I SGPPSIGSLEY Sbjct: 780 WESFVNNVWYIKILSPEDIQKMGEQAVESLALGSGQRLNGTGAESQDIVSGPPSIGSLEY 839 >XP_003553137.1 PREDICTED: auxin response factor 8-like [Glycine max] KHN08745.1 Auxin response factor 8 [Glycine soja] KRG98044.1 hypothetical protein GLYMA_18G046800 [Glycine max] Length = 841 Score = 112 bits (279), Expect = 5e-25 Identities = 54/60 (90%), Positives = 54/60 (90%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGEQAVES AL SGQRLNG GAES I SGPPSIGSLEY Sbjct: 782 WESFVNNVWYIKILSPEDIQKMGEQAVESLALGSGQRLNGTGAESQDIVSGPPSIGSLEY 841 >XP_014518561.1 PREDICTED: auxin response factor 8 isoform X2 [Vigna radiata var. radiata] Length = 843 Score = 112 bits (279), Expect = 5e-25 Identities = 54/60 (90%), Positives = 54/60 (90%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGEQAVES AL SGQRLNG GAES I SGPPSIGSLEY Sbjct: 784 WESFVNNVWYIKILSPEDIQKMGEQAVESLALGSGQRLNGTGAESQDIVSGPPSIGSLEY 843 >XP_014518560.1 PREDICTED: auxin response factor 8 isoform X1 [Vigna radiata var. radiata] Length = 844 Score = 112 bits (279), Expect = 5e-25 Identities = 54/60 (90%), Positives = 54/60 (90%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGEQAVES AL SGQRLNG GAES I SGPPSIGSLEY Sbjct: 785 WESFVNNVWYIKILSPEDIQKMGEQAVESLALGSGQRLNGTGAESQDIVSGPPSIGSLEY 844 >XP_007146949.1 hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris] ESW18943.1 hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris] Length = 840 Score = 110 bits (276), Expect = 1e-24 Identities = 53/60 (88%), Positives = 54/60 (90%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGEQAVES AL SGQRLNG GAES I SGPPSIGSL+Y Sbjct: 781 WESFVNNVWYIKILSPEDIQKMGEQAVESLALGSGQRLNGTGAESQDIVSGPPSIGSLDY 840 >XP_007146950.1 hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris] ESW18944.1 hypothetical protein PHAVU_006G084200g [Phaseolus vulgaris] Length = 841 Score = 110 bits (276), Expect = 1e-24 Identities = 53/60 (88%), Positives = 54/60 (90%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGEQAVES AL SGQRLNG GAES I SGPPSIGSL+Y Sbjct: 782 WESFVNNVWYIKILSPEDIQKMGEQAVESLALGSGQRLNGTGAESQDIVSGPPSIGSLDY 841 >XP_006591281.1 PREDICTED: auxin response factor 8-like [Glycine max] XP_014619664.1 PREDICTED: auxin response factor 8-like [Glycine max] KRH30740.1 hypothetical protein GLYMA_11G204200 [Glycine max] KRH30741.1 hypothetical protein GLYMA_11G204200 [Glycine max] Length = 844 Score = 110 bits (276), Expect = 1e-24 Identities = 53/60 (88%), Positives = 54/60 (90%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMG+QAVES AL SGQRLNG GAES I SGPPSIGSLEY Sbjct: 785 WESFVNNVWYIKILSPEDIQKMGDQAVESLALGSGQRLNGTGAESQDIVSGPPSIGSLEY 844 >GAU44115.1 hypothetical protein TSUD_124020 [Trifolium subterraneum] Length = 534 Score = 106 bits (265), Expect = 2e-23 Identities = 54/61 (88%), Positives = 55/61 (90%), Gaps = 1/61 (1%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASG-PPSIGSLE 435 WESFVNNVWYIKILSPEDIQKMGEQAVE+ AL SGQRLNG G ESHHI SG PPSIGSLE Sbjct: 475 WESFVNNVWYIKILSPEDIQKMGEQAVETLALGSGQRLNGTG-ESHHIVSGQPPSIGSLE 533 Query: 434 Y 432 Y Sbjct: 534 Y 534 >XP_012571326.1 PREDICTED: auxin response factor 8 [Cicer arietinum] XP_012571327.1 PREDICTED: auxin response factor 8 [Cicer arietinum] Length = 853 Score = 106 bits (265), Expect = 3e-23 Identities = 51/61 (83%), Positives = 56/61 (91%), Gaps = 1/61 (1%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASG-PPSIGSLE 435 WESFVNNVWYIKILSPEDIQKMGEQAVE+ AL SGQRL+ +GA+SHH+ SG PPSIGSLE Sbjct: 793 WESFVNNVWYIKILSPEDIQKMGEQAVETHALGSGQRLSDSGADSHHVVSGQPPSIGSLE 852 Query: 434 Y 432 Y Sbjct: 853 Y 853 >KYP76045.1 Auxin response factor 8 [Cajanus cajan] Length = 754 Score = 106 bits (264), Expect = 4e-23 Identities = 54/60 (90%), Positives = 54/60 (90%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGEQAVES ALSSGQRL NGAES I SGPPSIGSLEY Sbjct: 697 WESFVNNVWYIKILSPEDIQKMGEQAVESLALSSGQRL--NGAESQDIVSGPPSIGSLEY 754 >XP_014504678.1 PREDICTED: auxin response factor 8-like isoform X2 [Vigna radiata var. radiata] Length = 767 Score = 105 bits (262), Expect = 8e-23 Identities = 51/60 (85%), Positives = 52/60 (86%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGEQAVES SSGQRLN GA+SH I SG PSIGSLEY Sbjct: 708 WESFVNNVWYIKILSPEDIQKMGEQAVESLGPSSGQRLNSTGADSHEIVSGLPSIGSLEY 767 >XP_017430293.1 PREDICTED: LOW QUALITY PROTEIN: auxin response factor 8-like [Vigna angularis] Length = 841 Score = 105 bits (262), Expect = 9e-23 Identities = 51/60 (85%), Positives = 52/60 (86%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGEQAVES SSGQRLN GA+SH I SG PSIGSLEY Sbjct: 782 WESFVNNVWYIKILSPEDIQKMGEQAVESLGPSSGQRLNSTGADSHEIVSGLPSIGSLEY 841 >XP_007141982.1 hypothetical protein PHAVU_008G242400g [Phaseolus vulgaris] ESW13976.1 hypothetical protein PHAVU_008G242400g [Phaseolus vulgaris] Length = 844 Score = 105 bits (262), Expect = 9e-23 Identities = 51/60 (85%), Positives = 52/60 (86%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGEQAVES SSGQRLN GA+SH I SG PSIGSLEY Sbjct: 785 WESFVNNVWYIKILSPEDIQKMGEQAVESLGPSSGQRLNSTGADSHEIVSGLPSIGSLEY 844 >BAT81321.1 hypothetical protein VIGAN_03101200 [Vigna angularis var. angularis] Length = 846 Score = 105 bits (262), Expect = 9e-23 Identities = 51/60 (85%), Positives = 52/60 (86%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGEQAVES SSGQRLN GA+SH I SG PSIGSLEY Sbjct: 787 WESFVNNVWYIKILSPEDIQKMGEQAVESLGPSSGQRLNSTGADSHEIVSGLPSIGSLEY 846 >XP_014504677.1 PREDICTED: auxin response factor 8-like isoform X1 [Vigna radiata var. radiata] Length = 847 Score = 105 bits (262), Expect = 9e-23 Identities = 51/60 (85%), Positives = 52/60 (86%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGEQAVES SSGQRLN GA+SH I SG PSIGSLEY Sbjct: 788 WESFVNNVWYIKILSPEDIQKMGEQAVESLGPSSGQRLNSTGADSHEIVSGLPSIGSLEY 847 >XP_004490754.1 PREDICTED: auxin response factor 8-like [Cicer arietinum] Length = 833 Score = 105 bits (261), Expect = 1e-22 Identities = 50/60 (83%), Positives = 52/60 (86%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGEQA+ES SSGQRLN GAESH I SG PS+GSLEY Sbjct: 774 WESFVNNVWYIKILSPEDIQKMGEQAIESLGPSSGQRLNNTGAESHDIVSGLPSLGSLEY 833 >XP_003616115.1 auxin response factor 2 [Medicago truncatula] AES99073.1 auxin response factor 2 [Medicago truncatula] Length = 841 Score = 103 bits (256), Expect = 5e-22 Identities = 48/60 (80%), Positives = 52/60 (86%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASGPPSIGSLEY 432 WESFVNNVWYIKILSPEDIQKMGE+A+ES SSGQR+N GAESH I SG PS+GSLEY Sbjct: 782 WESFVNNVWYIKILSPEDIQKMGEEAIESLGPSSGQRMNNTGAESHDIVSGLPSLGSLEY 841 >XP_013460551.1 auxin response factor 2 [Medicago truncatula] KEH34585.1 auxin response factor 2 [Medicago truncatula] Length = 612 Score = 101 bits (252), Expect = 2e-21 Identities = 51/61 (83%), Positives = 53/61 (86%), Gaps = 1/61 (1%) Frame = -1 Query: 611 WESFVNNVWYIKILSPEDIQKMGEQAVESFALSSGQRLNGNGAESHHIASG-PPSIGSLE 435 WESFVNNVWYIKILSPEDIQKMG+QAVE L SGQRLNG G ESHHI SG PPSIGSL+ Sbjct: 553 WESFVNNVWYIKILSPEDIQKMGDQAVEMHGLGSGQRLNGTG-ESHHIVSGQPPSIGSLD 611 Query: 434 Y 432 Y Sbjct: 612 Y 612