BLASTX nr result
ID: Glycyrrhiza29_contig00015772
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00015772 (289 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013453017.1 Nodule Cysteine-Rich (NCR) secreted peptide [Medi... 54 5e-07 XP_004485710.2 PREDICTED: protein YLS3 [Cicer arietinum] 52 8e-06 >XP_013453017.1 Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula] KEH27045.1 Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula] Length = 137 Score = 53.9 bits (128), Expect = 5e-07 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = +3 Query: 162 ASPAFSVPPRPGLMGIGFGRSEAISLKARNGLMVM 266 ASP FSVPPRP ++G G GRSEAI+L A+NG++V+ Sbjct: 94 ASPLFSVPPRPSIIGFGLGRSEAINLNAKNGIIVI 128 >XP_004485710.2 PREDICTED: protein YLS3 [Cicer arietinum] Length = 192 Score = 51.6 bits (122), Expect = 8e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +3 Query: 162 ASPAFSVPPRPGLMGIGFGRSEAISLKARNGLMVMT 269 ASPAFSVPPRP +MG+ GRSEAI+LK N +V+T Sbjct: 144 ASPAFSVPPRPSIMGMVVGRSEAINLKTNNKFIVVT 179