BLASTX nr result
ID: Glycyrrhiza29_contig00015583
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00015583 (373 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013469912.1 cysteine-rich receptor-kinase-like protein [Medic... 58 3e-07 GAU14938.1 hypothetical protein TSUD_47310 [Trifolium subterraneum] 54 5e-06 >XP_013469912.1 cysteine-rich receptor-kinase-like protein [Medicago truncatula] KEH43950.1 cysteine-rich receptor-kinase-like protein [Medicago truncatula] Length = 693 Score = 57.8 bits (138), Expect = 3e-07 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = +2 Query: 263 MLIILKSEANEQLIFRYHECNNILGNFTPGSTYNKNR 373 + ILK+EA++QLIFRYHECN +LGNFT GS Y NR Sbjct: 14 LFFILKTEASDQLIFRYHECNQMLGNFTGGSAYQINR 50 >GAU14938.1 hypothetical protein TSUD_47310 [Trifolium subterraneum] Length = 682 Score = 54.3 bits (129), Expect = 5e-06 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +2 Query: 263 MLIILKSEANEQLIFRYHECNNILGNFTPGSTYNKNR 373 + L SEAN+QL+FRYH CN LGNFT GS Y NR Sbjct: 14 LFFTLNSEANDQLVFRYHACNQDLGNFTKGSVYENNR 50