BLASTX nr result
ID: Glycyrrhiza29_contig00015251
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00015251 (291 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CNJ48920.1 Uncharacterised protein [Mycobacterium tuberculosis] 58 3e-08 EID19495.1 hypothetical protein HMPREF1043_0707 [Streptococcus a... 58 3e-08 >CNJ48920.1 Uncharacterised protein [Mycobacterium tuberculosis] Length = 189 Score = 58.2 bits (139), Expect = 3e-08 Identities = 33/67 (49%), Positives = 40/67 (59%), Gaps = 4/67 (5%) Frame = +1 Query: 1 FLGSIGSLNSPNRGTHRISGIIDDGFAYRQPYILTPGSP----YGYHRLAQLPSCVTPVN 168 FLGSIGS N P G+H +SG QP LT +P + HR+A LPSCVTPVN Sbjct: 73 FLGSIGSPNPPKTGSHHVSGT--------QPAHLTTDNPTRLDHDNHRVAWLPSCVTPVN 124 Query: 169 TLTAPER 189 T T+ +R Sbjct: 125 TFTSKDR 131 >EID19495.1 hypothetical protein HMPREF1043_0707 [Streptococcus anginosus subsp. whileyi CCUG 39159] Length = 191 Score = 58.2 bits (139), Expect = 3e-08 Identities = 38/73 (52%), Positives = 45/73 (61%), Gaps = 2/73 (2%) Frame = +1 Query: 1 FLGSIGSLNSPNRGTHRISGI--IDDGFAYRQPYILTPGSPYGYHRLAQLPSCVTPVNTL 174 FLGSIGS + P G R SG+ GF YRQPY L PG +H A+LPSCVTPVN L Sbjct: 73 FLGSIGSPDHPPCG--RPSGLRHTAGGFTYRQPYTLRPGH---FHCPARLPSCVTPVNAL 127 Query: 175 TAPERGRALDRSP 213 +P + + RSP Sbjct: 128 ASPVQ---VPRSP 137