BLASTX nr result
ID: Glycyrrhiza29_contig00012942
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00012942 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013461282.1 BTB/POZ domain plant protein [Medicago truncatula... 145 2e-42 XP_013461280.1 BTB/POZ domain plant protein [Medicago truncatula... 145 9e-42 XP_013461281.1 BTB/POZ domain plant protein [Medicago truncatula... 145 1e-41 XP_003526644.1 PREDICTED: BTB/POZ domain-containing protein At1g... 146 2e-41 KYP69964.1 TD and POZ domain-containing protein 2 [Cajanus cajan] 146 4e-41 XP_003602063.1 BTB/POZ domain plant protein [Medicago truncatula... 145 5e-41 ACJ86277.1 unknown [Medicago truncatula] AFK34955.1 unknown [Med... 145 5e-41 XP_015934600.1 PREDICTED: BTB/POZ domain-containing protein At1g... 145 7e-41 XP_004502495.1 PREDICTED: BTB/POZ domain-containing protein At1g... 145 9e-41 ACU19579.1 unknown [Glycine max] 144 3e-40 XP_014500151.1 PREDICTED: BTB/POZ domain-containing protein At1g... 143 5e-40 XP_017420987.1 PREDICTED: BTB/POZ domain-containing protein At1g... 143 5e-40 GAU22834.1 hypothetical protein TSUD_282010 [Trifolium subterran... 143 6e-40 AHA84273.1 BTB/POZ domain-containing protein [Phaseolus vulgaris] 142 1e-39 XP_019417850.1 PREDICTED: BTB/POZ domain-containing protein At1g... 141 3e-39 OIV96654.1 hypothetical protein TanjilG_09196 [Lupinus angustifo... 141 3e-39 XP_007137443.1 hypothetical protein PHAVU_009G127400g [Phaseolus... 140 8e-39 XP_015885682.1 PREDICTED: BTB/POZ domain-containing protein At1g... 140 8e-39 XP_015885680.1 PREDICTED: BTB/POZ domain-containing protein At1g... 140 9e-39 XP_002513752.1 PREDICTED: BTB/POZ domain-containing protein At1g... 139 2e-38 >XP_013461282.1 BTB/POZ domain plant protein [Medicago truncatula] KEH35317.1 BTB/POZ domain plant protein [Medicago truncatula] Length = 205 Score = 145 bits (367), Expect = 2e-42 Identities = 72/77 (93%), Positives = 74/77 (96%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYG+IKQ DFRKH LA Sbjct: 53 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGAIKQVDFRKHCLA 112 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI GLKD+C Sbjct: 113 LLGAANKYDIGGLKDLC 129 >XP_013461280.1 BTB/POZ domain plant protein [Medicago truncatula] KEH35315.1 BTB/POZ domain plant protein [Medicago truncatula] Length = 257 Score = 145 bits (367), Expect = 9e-42 Identities = 72/77 (93%), Positives = 74/77 (96%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYG+IKQ DFRKH LA Sbjct: 105 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGAIKQVDFRKHCLA 164 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI GLKD+C Sbjct: 165 LLGAANKYDIGGLKDLC 181 >XP_013461281.1 BTB/POZ domain plant protein [Medicago truncatula] KEH35316.1 BTB/POZ domain plant protein [Medicago truncatula] Length = 272 Score = 145 bits (367), Expect = 1e-41 Identities = 72/77 (93%), Positives = 74/77 (96%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYG+IKQ DFRKH LA Sbjct: 120 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGAIKQVDFRKHCLA 179 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI GLKD+C Sbjct: 180 LLGAANKYDIGGLKDLC 196 >XP_003526644.1 PREDICTED: BTB/POZ domain-containing protein At1g21780 [Glycine max] KHN47002.1 BTB/POZ domain-containing protein [Glycine soja] KRH53265.1 hypothetical protein GLYMA_06G115300 [Glycine max] KRH53266.1 hypothetical protein GLYMA_06G115300 [Glycine max] Length = 327 Score = 146 bits (369), Expect = 2e-41 Identities = 72/77 (93%), Positives = 74/77 (96%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKA+LSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYG+IKQEDF KHRLA Sbjct: 176 HKAVLSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGAIKQEDFWKHRLA 235 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI LKDIC Sbjct: 236 LLGAANKYDIGSLKDIC 252 >KYP69964.1 TD and POZ domain-containing protein 2 [Cajanus cajan] Length = 327 Score = 146 bits (368), Expect = 4e-41 Identities = 70/77 (90%), Positives = 75/77 (97%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKA+LSASSPVFQSMFHHNLKEKESSTIHI+DMSLESCTALLSY+YG+IKQEDF KHRLA Sbjct: 175 HKAVLSASSPVFQSMFHHNLKEKESSTIHIQDMSLESCTALLSYIYGTIKQEDFWKHRLA 234 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYD+ GLKDIC Sbjct: 235 LLGAANKYDLGGLKDIC 251 >XP_003602063.1 BTB/POZ domain plant protein [Medicago truncatula] AES72314.1 BTB/POZ domain plant protein [Medicago truncatula] Length = 327 Score = 145 bits (367), Expect = 5e-41 Identities = 72/77 (93%), Positives = 74/77 (96%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYG+IKQ DFRKH LA Sbjct: 175 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGAIKQVDFRKHCLA 234 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI GLKD+C Sbjct: 235 LLGAANKYDIGGLKDLC 251 >ACJ86277.1 unknown [Medicago truncatula] AFK34955.1 unknown [Medicago truncatula] Length = 327 Score = 145 bits (367), Expect = 5e-41 Identities = 72/77 (93%), Positives = 74/77 (96%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYG+IKQ DFRKH LA Sbjct: 175 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGAIKQVDFRKHCLA 234 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI GLKD+C Sbjct: 235 LLGAANKYDIGGLKDLC 251 >XP_015934600.1 PREDICTED: BTB/POZ domain-containing protein At1g21780 [Arachis duranensis] XP_015945490.1 PREDICTED: BTB/POZ domain-containing protein At1g21780-like [Arachis duranensis] XP_016163485.1 PREDICTED: BTB/POZ domain-containing protein At1g21780 [Arachis ipaensis] Length = 328 Score = 145 bits (366), Expect = 7e-41 Identities = 70/77 (90%), Positives = 74/77 (96%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKAILSASSPVFQSMFHHNL+EKESSTIHIEDMSLESCTALL YLYG+IKQ+DF KHRLA Sbjct: 177 HKAILSASSPVFQSMFHHNLREKESSTIHIEDMSLESCTALLRYLYGTIKQDDFWKHRLA 236 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI GLKD+C Sbjct: 237 LLGAANKYDITGLKDVC 253 >XP_004502495.1 PREDICTED: BTB/POZ domain-containing protein At1g21780 [Cicer arietinum] Length = 324 Score = 145 bits (365), Expect = 9e-41 Identities = 71/77 (92%), Positives = 74/77 (96%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKAI+SASSPVFQSMFHH+LKEKESSTIHIEDMSLESCTALL YLYGSIKQEDFRKH LA Sbjct: 172 HKAIMSASSPVFQSMFHHDLKEKESSTIHIEDMSLESCTALLRYLYGSIKQEDFRKHCLA 231 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI GLKD+C Sbjct: 232 LLGAANKYDIGGLKDLC 248 >ACU19579.1 unknown [Glycine max] Length = 327 Score = 144 bits (362), Expect = 3e-40 Identities = 71/77 (92%), Positives = 73/77 (94%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKA+LSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYG+IKQEDF KHRLA Sbjct: 176 HKAVLSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGAIKQEDFWKHRLA 235 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI LK IC Sbjct: 236 LLGAANKYDIGSLKGIC 252 >XP_014500151.1 PREDICTED: BTB/POZ domain-containing protein At1g21780 [Vigna radiata var. radiata] Length = 325 Score = 143 bits (360), Expect = 5e-40 Identities = 69/77 (89%), Positives = 74/77 (96%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKA+LSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCT LLS+LYG+IK++DF KHRLA Sbjct: 172 HKAVLSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTVLLSFLYGTIKKKDFLKHRLA 231 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI GLKDIC Sbjct: 232 LLGAANKYDIGGLKDIC 248 >XP_017420987.1 PREDICTED: BTB/POZ domain-containing protein At1g21780 [Vigna angularis] KOM41552.1 hypothetical protein LR48_Vigan04g175000 [Vigna angularis] BAT78666.1 hypothetical protein VIGAN_02137700 [Vigna angularis var. angularis] Length = 325 Score = 143 bits (360), Expect = 5e-40 Identities = 69/77 (89%), Positives = 75/77 (97%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKA+LSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLS+LYG+IK++DF +HRLA Sbjct: 172 HKAVLSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSFLYGTIKKKDFLEHRLA 231 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI GLKDIC Sbjct: 232 LLGAANKYDIGGLKDIC 248 >GAU22834.1 hypothetical protein TSUD_282010 [Trifolium subterraneum] Length = 327 Score = 143 bits (360), Expect = 6e-40 Identities = 71/77 (92%), Positives = 73/77 (94%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYG+IKQE FRKH LA Sbjct: 175 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGAIKQEAFRKHCLA 234 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI LKD+C Sbjct: 235 LLGAANKYDIGSLKDLC 251 >AHA84273.1 BTB/POZ domain-containing protein [Phaseolus vulgaris] Length = 323 Score = 142 bits (358), Expect = 1e-39 Identities = 67/77 (87%), Positives = 75/77 (97%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKA+LS+SSPVF+SMFHHNLKEKESSTIH+EDMSLESCTAL+S+LYG+IKQ+DF KHRLA Sbjct: 172 HKAVLSSSSPVFRSMFHHNLKEKESSTIHVEDMSLESCTALISFLYGTIKQQDFWKHRLA 231 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI GLKDIC Sbjct: 232 LLGAANKYDIDGLKDIC 248 >XP_019417850.1 PREDICTED: BTB/POZ domain-containing protein At1g21780-like [Lupinus angustifolius] Length = 326 Score = 141 bits (355), Expect = 3e-39 Identities = 70/77 (90%), Positives = 72/77 (93%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKAILSASSPVFQSMFHHNLKEKESSTI IEDMS ESCT LLSYLYG+IKQEDF KHRLA Sbjct: 175 HKAILSASSPVFQSMFHHNLKEKESSTIRIEDMSPESCTVLLSYLYGTIKQEDFWKHRLA 234 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI GLKD+C Sbjct: 235 LLGAANKYDIGGLKDLC 251 >OIV96654.1 hypothetical protein TanjilG_09196 [Lupinus angustifolius] Length = 327 Score = 141 bits (355), Expect = 3e-39 Identities = 70/77 (90%), Positives = 72/77 (93%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKAILSASSPVFQSMFHHNLKEKESSTI IEDMS ESCT LLSYLYG+IKQEDF KHRLA Sbjct: 176 HKAILSASSPVFQSMFHHNLKEKESSTIRIEDMSPESCTVLLSYLYGTIKQEDFWKHRLA 235 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI GLKD+C Sbjct: 236 LLGAANKYDIGGLKDLC 252 >XP_007137443.1 hypothetical protein PHAVU_009G127400g [Phaseolus vulgaris] ESW09437.1 hypothetical protein PHAVU_009G127400g [Phaseolus vulgaris] Length = 322 Score = 140 bits (352), Expect = 8e-39 Identities = 66/77 (85%), Positives = 74/77 (96%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKA+LS+SSPVF+SMFHHNLKEKESSTIH+EDMSLESCTAL+S+LYG+IKQ+DF KHRLA Sbjct: 171 HKAVLSSSSPVFRSMFHHNLKEKESSTIHVEDMSLESCTALISFLYGTIKQQDFWKHRLA 230 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI LKDIC Sbjct: 231 LLGAANKYDIDSLKDIC 247 >XP_015885682.1 PREDICTED: BTB/POZ domain-containing protein At1g21780-like isoform X2 [Ziziphus jujuba] XP_015885715.1 PREDICTED: BTB/POZ domain-containing protein At1g21780-like isoform X2 [Ziziphus jujuba] Length = 326 Score = 140 bits (352), Expect = 8e-39 Identities = 69/77 (89%), Positives = 71/77 (92%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKAILSASS VFQSMFHHNLKEKESSTIHIEDMS+ESC ALLSYLYG+IKQEDF KHRLA Sbjct: 175 HKAILSASSSVFQSMFHHNLKEKESSTIHIEDMSMESCVALLSYLYGTIKQEDFWKHRLA 234 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI LKD C Sbjct: 235 LLGAANKYDIADLKDAC 251 >XP_015885680.1 PREDICTED: BTB/POZ domain-containing protein At1g21780-like isoform X1 [Ziziphus jujuba] XP_015885714.1 PREDICTED: BTB/POZ domain-containing protein At1g21780-like isoform X1 [Ziziphus jujuba] Length = 328 Score = 140 bits (352), Expect = 9e-39 Identities = 69/77 (89%), Positives = 71/77 (92%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKAILSASS VFQSMFHHNLKEKESSTIHIEDMS+ESC ALLSYLYG+IKQEDF KHRLA Sbjct: 177 HKAILSASSSVFQSMFHHNLKEKESSTIHIEDMSMESCVALLSYLYGTIKQEDFWKHRLA 236 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI LKD C Sbjct: 237 LLGAANKYDIADLKDAC 253 >XP_002513752.1 PREDICTED: BTB/POZ domain-containing protein At1g21780 [Ricinus communis] EEF48335.1 protein with unknown function [Ricinus communis] Length = 326 Score = 139 bits (349), Expect = 2e-38 Identities = 68/77 (88%), Positives = 72/77 (93%) Frame = -3 Query: 269 HKAILSASSPVFQSMFHHNLKEKESSTIHIEDMSLESCTALLSYLYGSIKQEDFRKHRLA 90 HKAILSASSPVFQSMFHHNLKEKESSTI+IEDMS+ESC +LLSYLYG+IKQEDF KHRLA Sbjct: 175 HKAILSASSPVFQSMFHHNLKEKESSTIYIEDMSMESCMSLLSYLYGTIKQEDFWKHRLA 234 Query: 89 LLGAANKYDICGLKDIC 39 LLGAANKYDI LKD C Sbjct: 235 LLGAANKYDISDLKDAC 251