BLASTX nr result
ID: Glycyrrhiza29_contig00010915
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00010915 (508 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP68276.1 hypothetical protein KK1_021897 [Cajanus cajan] 65 4e-09 XP_003540667.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 2e-08 XP_003539003.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 1e-07 KOM50945.1 hypothetical protein LR48_Vigan08g177200 [Vigna angul... 59 4e-07 XP_017433852.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 4e-07 XP_017433851.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 4e-07 XP_014524331.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 1e-06 GAU34555.1 hypothetical protein TSUD_219390 [Trifolium subterran... 56 4e-06 >KYP68276.1 hypothetical protein KK1_021897 [Cajanus cajan] Length = 718 Score = 64.7 bits (156), Expect = 4e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +2 Query: 365 HDPHDPIYKFFKTRTLVSSQSPGKEGKLSLLRNHRV 472 HDP DPIYKFFKTRT VSSQ PGKEGKLSL +N R+ Sbjct: 91 HDPDDPIYKFFKTRTRVSSQDPGKEGKLSLQKNRRI 126 >XP_003540667.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic-like [Glycine max] KRH24378.1 hypothetical protein GLYMA_12G037500 [Glycine max] Length = 711 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +2 Query: 365 HDPHDPIYKFFKTRTLVSSQSPGKEGKLSLLRNHRV 472 HDP DPIYKFFKTRT SSQ PGKEGKLSL +N R+ Sbjct: 92 HDPDDPIYKFFKTRTRFSSQDPGKEGKLSLQKNRRI 127 >XP_003539003.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic-like [Glycine max] KHN39840.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] KRH29350.1 hypothetical protein GLYMA_11G111200 [Glycine max] Length = 703 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +2 Query: 365 HDPHDPIYKFFKTRTLVSSQSPGKEGKLSLLRNHRV 472 +DP DPIYKFFKTRT SSQ PGKEGKLSL +N R+ Sbjct: 84 YDPDDPIYKFFKTRTRFSSQDPGKEGKLSLQKNRRI 119 >KOM50945.1 hypothetical protein LR48_Vigan08g177200 [Vigna angularis] Length = 687 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 368 DPHDPIYKFFKTRTLVSSQSPGKEGKLSLLRNHRV 472 DP DPIYKFFKTRT +S Q PGKEGKLSL +N R+ Sbjct: 90 DPDDPIYKFFKTRTRISFQDPGKEGKLSLQKNRRI 124 >XP_017433852.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X2 [Vigna angularis] Length = 714 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 368 DPHDPIYKFFKTRTLVSSQSPGKEGKLSLLRNHRV 472 DP DPIYKFFKTRT +S Q PGKEGKLSL +N R+ Sbjct: 90 DPDDPIYKFFKTRTRISFQDPGKEGKLSLQKNRRI 124 >XP_017433851.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic isoform X1 [Vigna angularis] BAT90987.1 hypothetical protein VIGAN_06228700 [Vigna angularis var. angularis] Length = 720 Score = 58.9 bits (141), Expect = 4e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +2 Query: 368 DPHDPIYKFFKTRTLVSSQSPGKEGKLSLLRNHRV 472 DP DPIYKFFKTRT +S Q PGKEGKLSL +N R+ Sbjct: 90 DPDDPIYKFFKTRTRISFQDPGKEGKLSLQKNRRI 124 >XP_014524331.1 PREDICTED: pentatricopeptide repeat-containing protein At5g50280, chloroplastic [Vigna radiata var. radiata] Length = 714 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +2 Query: 368 DPHDPIYKFFKTRTLVSSQSPGKEGKLSLLRNHRV 472 DP DPIYKFFKTRT +S Q PGKEG+LSL +N R+ Sbjct: 93 DPDDPIYKFFKTRTRISFQDPGKEGRLSLQKNRRI 127 >GAU34555.1 hypothetical protein TSUD_219390 [Trifolium subterraneum] Length = 738 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = +2 Query: 356 PSHHDPHDPIYKFFKTRTLVSSQSPGKEGKLSLLRNHR 469 P + DP DPIYKFFKTRT VSSQ+P +EGK+ L N R Sbjct: 117 PYYDDPDDPIYKFFKTRTTVSSQNPAREGKMLLQNNRR 154