BLASTX nr result
ID: Glycyrrhiza29_contig00009333
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00009333 (236 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP77543.1 hypothetical protein KK1_049123, partial [Cajanus cajan] 64 2e-11 EEF27212.1 conserved hypothetical protein, partial [Ricinus comm... 50 2e-09 >KYP77543.1 hypothetical protein KK1_049123, partial [Cajanus cajan] Length = 135 Score = 64.3 bits (155), Expect = 2e-11 Identities = 32/35 (91%), Positives = 33/35 (94%) Frame = +2 Query: 2 LSCPKTCFILIGERLSRGKVLHIGPAAFFISLAVS 106 LS KTCFILIGERLSRGKVLHIGPAAFFISLAV+ Sbjct: 63 LSGQKTCFILIGERLSRGKVLHIGPAAFFISLAVN 97 >EEF27212.1 conserved hypothetical protein, partial [Ricinus communis] Length = 86 Score = 50.1 bits (118), Expect(2) = 2e-09 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -2 Query: 172 EK*NPSGLSPGTDPNRKKGARRTNGKRDKESSWPYV 65 +K NPSGL+P P + KGARRT GKRDKESSWP V Sbjct: 52 KKYNPSGLTPPGGP-QPKGARRTKGKRDKESSWPLV 86 Score = 38.9 bits (89), Expect(2) = 2e-09 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -3 Query: 234 KEQRIYKSNGRGMADTLTAFEKNR 163 KEQRIYKSNG MADTLTAF+ + Sbjct: 30 KEQRIYKSNGIRMADTLTAFDTKK 53