BLASTX nr result
ID: Glycyrrhiza29_contig00009193
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00009193 (300 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016165756.1 PREDICTED: leucine-rich repeat extensin-like prot... 55 3e-07 >XP_016165756.1 PREDICTED: leucine-rich repeat extensin-like protein 5 [Arachis ipaensis] Length = 165 Score = 55.1 bits (131), Expect = 3e-07 Identities = 28/51 (54%), Positives = 35/51 (68%) Frame = -2 Query: 206 QPQPTVISGPHDXXXXXXXXYASGASSLSIHAPIFVLLFLFLIGYYSIVGK 54 + +PTVISGPHD Y+S ASSLS H F +L LFL+GY+S+VGK Sbjct: 115 EAEPTVISGPHDYYYPYYYFYSSCASSLSNHHAPFFILLLFLVGYFSLVGK 165