BLASTX nr result
ID: Glycyrrhiza29_contig00009035
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00009035 (301 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP31455.1 40S ribosomal protein S6 [Cajanus cajan] 67 4e-11 KHN22176.1 40S ribosomal protein S6-2 [Glycine soja] 60 8e-10 KHN46652.1 40S ribosomal protein S6-2, partial [Glycine soja] 60 8e-10 XP_015646376.1 PREDICTED: 40S ribosomal protein S6 [Oryza sativa... 63 1e-09 XP_007140716.1 hypothetical protein PHAVU_008G135700g [Phaseolus... 62 1e-09 XP_007148148.1 hypothetical protein PHAVU_006G184300g [Phaseolus... 62 2e-09 XP_004492256.1 PREDICTED: 40S ribosomal protein S6-like [Cicer a... 62 2e-09 XP_003547761.1 PREDICTED: 40S ribosomal protein S6-like [Glycine... 62 2e-09 KOM24736.1 hypothetical protein LR48_Vigan2478s000100, partial [... 62 2e-09 KYP31588.1 40S ribosomal protein S6 [Cajanus cajan] 62 2e-09 XP_017411761.1 PREDICTED: 40S ribosomal protein S6-like [Vigna a... 62 2e-09 XP_015694731.1 PREDICTED: serine/threonine-protein kinase SAPK2 ... 63 2e-09 XP_017416033.1 PREDICTED: 40S ribosomal protein S6 [Vigna angula... 62 3e-09 XP_007140717.1 hypothetical protein PHAVU_008G135700g [Phaseolus... 62 3e-09 EAY90299.1 hypothetical protein OsI_11874 [Oryza sativa Indica G... 62 3e-09 XP_019425273.1 PREDICTED: 40S ribosomal protein S6-2-like [Lupin... 59 4e-09 KRH10901.1 hypothetical protein GLYMA_15G075600 [Glycine max] 61 4e-09 XP_003532242.1 PREDICTED: 40S ribosomal protein S6 [Glycine max]... 61 4e-09 ACU23723.1 unknown [Glycine max] 61 4e-09 XP_014516877.1 PREDICTED: 40S ribosomal protein S6-like [Vigna r... 61 4e-09 >KYP31455.1 40S ribosomal protein S6 [Cajanus cajan] Length = 251 Score = 66.6 bits (161), Expect = 4e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAATV 132 YQKLLASRLKEQRERRSESLAKRRSK+SSVSK AATV Sbjct: 215 YQKLLASRLKEQRERRSESLAKRRSKLSSVSKQAATV 251 >KHN22176.1 40S ribosomal protein S6-2 [Glycine soja] Length = 91 Score = 60.1 bits (144), Expect = 8e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAAT 135 YQKLLASRLKEQRE RSESLAKRRSK+SSV+K +AT Sbjct: 55 YQKLLASRLKEQRELRSESLAKRRSKLSSVAKQSAT 90 >KHN46652.1 40S ribosomal protein S6-2, partial [Glycine soja] Length = 92 Score = 60.1 bits (144), Expect = 8e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAAT 135 YQKLLASRLKEQRE RSESLAKRRSK+SSV+K +AT Sbjct: 56 YQKLLASRLKEQRELRSESLAKRRSKLSSVAKQSAT 91 >XP_015646376.1 PREDICTED: 40S ribosomal protein S6 [Oryza sativa Japonica Group] BAC10193.1 putative 40S ribosomal protein S6 [Oryza sativa Japonica Group] BAF22227.1 Os07g0622100 [Oryza sativa Japonica Group] EAZ04750.1 hypothetical protein OsI_26912 [Oryza sativa Indica Group] EAZ40700.1 hypothetical protein OsJ_25168 [Oryza sativa Japonica Group] BAG91448.1 unnamed protein product [Oryza sativa Japonica Group] BAT02705.1 Os07g0622100 [Oryza sativa Japonica Group] Length = 250 Score = 62.8 bits (151), Expect = 1e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAAT 135 YQKLLA RLKEQRERRSESLAKRRSK+SS +KAAAT Sbjct: 213 YQKLLAQRLKEQRERRSESLAKRRSKLSSAAKAAAT 248 >XP_007140716.1 hypothetical protein PHAVU_008G135700g [Phaseolus vulgaris] ESW12710.1 hypothetical protein PHAVU_008G135700g [Phaseolus vulgaris] Length = 185 Score = 61.6 bits (148), Expect = 1e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAA 141 YQKLLASRLKEQRERRSESLAKRRSKISS +KAA Sbjct: 151 YQKLLASRLKEQRERRSESLAKRRSKISSATKAA 184 >XP_007148148.1 hypothetical protein PHAVU_006G184300g [Phaseolus vulgaris] ESW20142.1 hypothetical protein PHAVU_006G184300g [Phaseolus vulgaris] Length = 249 Score = 62.4 bits (150), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAAT 135 YQKLLASRLKEQRERRSESLAKRRSK+SS +K AAT Sbjct: 213 YQKLLASRLKEQRERRSESLAKRRSKLSSATKPAAT 248 >XP_004492256.1 PREDICTED: 40S ribosomal protein S6-like [Cicer arietinum] Length = 249 Score = 62.4 bits (150), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAAT 135 YQKLLASRLKEQRERRSES+AKRRSK+SS SK AAT Sbjct: 213 YQKLLASRLKEQRERRSESVAKRRSKLSSASKPAAT 248 >XP_003547761.1 PREDICTED: 40S ribosomal protein S6-like [Glycine max] KRH07350.1 hypothetical protein GLYMA_16G082800 [Glycine max] Length = 249 Score = 62.4 bits (150), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAAT 135 YQKLLASRLKEQRERRSESLAKRRSK+SS +K AAT Sbjct: 213 YQKLLASRLKEQRERRSESLAKRRSKLSSAAKQAAT 248 >KOM24736.1 hypothetical protein LR48_Vigan2478s000100, partial [Vigna angularis] Length = 225 Score = 62.0 bits (149), Expect = 2e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAA 138 YQKLLASRLKEQRERRSESLAKRRSKISSVSK A Sbjct: 189 YQKLLASRLKEQRERRSESLAKRRSKISSVSKQPA 223 >KYP31588.1 40S ribosomal protein S6 [Cajanus cajan] Length = 249 Score = 62.0 bits (149), Expect = 2e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAAT 135 YQKLLASRLKEQR+RRSESLAKRRSK+SS +KA AT Sbjct: 213 YQKLLASRLKEQRDRRSESLAKRRSKVSSATKAVAT 248 >XP_017411761.1 PREDICTED: 40S ribosomal protein S6-like [Vigna angularis] BAT96981.1 hypothetical protein VIGAN_09031600 [Vigna angularis var. angularis] Length = 249 Score = 62.0 bits (149), Expect = 2e-09 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAA 138 YQKLLASRLKEQRERRSESLAKRRSKISSVSK A Sbjct: 213 YQKLLASRLKEQRERRSESLAKRRSKISSVSKQPA 247 >XP_015694731.1 PREDICTED: serine/threonine-protein kinase SAPK2 [Oryza brachyantha] Length = 645 Score = 62.8 bits (151), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAAT 135 YQKLLA RLKEQRERRSESLAKRRSK+SS +KAAAT Sbjct: 608 YQKLLAQRLKEQRERRSESLAKRRSKLSSAAKAAAT 643 >XP_017416033.1 PREDICTED: 40S ribosomal protein S6 [Vigna angularis] BAT84218.1 hypothetical protein VIGAN_04152900 [Vigna angularis var. angularis] Length = 247 Score = 61.6 bits (148), Expect = 3e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAA 141 YQKLLASRLKEQRERRSESLAKRRSKISS +KAA Sbjct: 213 YQKLLASRLKEQRERRSESLAKRRSKISSATKAA 246 >XP_007140717.1 hypothetical protein PHAVU_008G135700g [Phaseolus vulgaris] XP_007140725.1 hypothetical protein PHAVU_008G136400g [Phaseolus vulgaris] AGV54885.1 40S ribosomal protein S6-like protein [Phaseolus vulgaris] ESW12711.1 hypothetical protein PHAVU_008G135700g [Phaseolus vulgaris] ESW12719.1 hypothetical protein PHAVU_008G136400g [Phaseolus vulgaris] Length = 247 Score = 61.6 bits (148), Expect = 3e-09 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAA 141 YQKLLASRLKEQRERRSESLAKRRSKISS +KAA Sbjct: 213 YQKLLASRLKEQRERRSESLAKRRSKISSATKAA 246 >EAY90299.1 hypothetical protein OsI_11874 [Oryza sativa Indica Group] Length = 250 Score = 61.6 bits (148), Expect = 3e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAAT 135 YQKLLA RLKEQRERRSESLAKRRSK+S+ +KAAAT Sbjct: 213 YQKLLAQRLKEQRERRSESLAKRRSKLSAATKAAAT 248 >XP_019425273.1 PREDICTED: 40S ribosomal protein S6-2-like [Lupinus angustifolius] Length = 116 Score = 58.9 bits (141), Expect = 4e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAAT 135 YQKLLASRLKEQRERRSESLAK+RS++SS +K +AT Sbjct: 80 YQKLLASRLKEQRERRSESLAKKRSRLSSATKPSAT 115 >KRH10901.1 hypothetical protein GLYMA_15G075600 [Glycine max] Length = 248 Score = 61.2 bits (147), Expect = 4e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAAT 135 YQKLLASRLKEQR+RRSESLAKRRSK+SS +K AAT Sbjct: 212 YQKLLASRLKEQRDRRSESLAKRRSKLSSAAKQAAT 247 >XP_003532242.1 PREDICTED: 40S ribosomal protein S6 [Glycine max] KRH46580.1 hypothetical protein GLYMA_08G343800 [Glycine max] Length = 248 Score = 61.2 bits (147), Expect = 4e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAA 138 YQKLLASRLKEQR+RRSESLAKRRSK+SS +KAAA Sbjct: 213 YQKLLASRLKEQRDRRSESLAKRRSKLSSAAKAAA 247 >ACU23723.1 unknown [Glycine max] Length = 248 Score = 61.2 bits (147), Expect = 4e-09 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAA 138 YQKLLASRLKEQR+RRSESLAKRRSK+SS +KAAA Sbjct: 213 YQKLLASRLKEQRDRRSESLAKRRSKLSSAAKAAA 247 >XP_014516877.1 PREDICTED: 40S ribosomal protein S6-like [Vigna radiata var. radiata] XP_017433954.1 PREDICTED: 40S ribosomal protein S6-like [Vigna angularis] BAT87094.1 hypothetical protein VIGAN_05043500 [Vigna angularis var. angularis] Length = 249 Score = 61.2 bits (147), Expect = 4e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -3 Query: 242 YQKLLASRLKEQRERRSESLAKRRSKISSVSKAAAT 135 YQKLLASRLKEQRERRSESLAKRRS++SS +K AAT Sbjct: 213 YQKLLASRLKEQRERRSESLAKRRSRLSSATKQAAT 248