BLASTX nr result
ID: Glycyrrhiza29_contig00008682
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00008682 (271 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_001324406.1 hypothetical protein AT2G07641 [Arabidopsis thali... 56 3e-07 >NP_001324406.1 hypothetical protein AT2G07641 [Arabidopsis thaliana] ANM62231.1 hypothetical protein AT2G07641 [Arabidopsis thaliana] Length = 266 Score = 55.8 bits (133), Expect = 3e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 16 RVNDGTKNSP*IQLFRTRSLASHTQVLSEPCNKV 117 RV +GTKN QLFRTRSLASHTQVLSEPCNK+ Sbjct: 13 RVENGTKNETLRQLFRTRSLASHTQVLSEPCNKL 46