BLASTX nr result
ID: Glycyrrhiza29_contig00008679
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00008679 (621 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN47655.1 hypothetical protein glysoja_037756 [Glycine soja] KR... 54 4e-06 >KHN47655.1 hypothetical protein glysoja_037756 [Glycine soja] KRH18258.1 hypothetical protein GLYMA_13G047000 [Glycine max] Length = 113 Score = 53.9 bits (128), Expect = 4e-06 Identities = 25/37 (67%), Positives = 25/37 (67%) Frame = +3 Query: 123 FNSSKPTCPAKPVTVNCKTTCLQQICWPFILLV*CPF 233 F K TCPAKPVTVNC TT LQQ CW FI L C F Sbjct: 23 FQQLKATCPAKPVTVNCWTTYLQQRCWLFIQLALCSF 59