BLASTX nr result
ID: Glycyrrhiza29_contig00006932
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00006932 (328 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAC78438.1 isoflavonoid glucosyltransferase [Glycyrrhiza echinata] 71 3e-12 KRH02148.1 hypothetical protein GLYMA_17G019400 [Glycine max] 57 3e-07 XP_006600323.1 PREDICTED: scopoletin glucosyltransferase-like [G... 57 3e-07 XP_014521976.1 PREDICTED: UDP-glucose flavonoid 3-O-glucosyltran... 57 4e-07 XP_007154186.1 hypothetical protein PHAVU_003G097200g [Phaseolus... 57 4e-07 KYP58166.1 Anthocyanin 3'-O-beta-glucosyltransferase [Cajanus ca... 55 1e-06 XP_003594819.1 UDP-glucosyltransferase family protein [Medicago ... 55 1e-06 GAU41620.1 hypothetical protein TSUD_196900 [Trifolium subterran... 55 1e-06 XP_003612854.1 UDP-glucosyltransferase family protein [Medicago ... 55 2e-06 XP_017422486.1 PREDICTED: UDP-glucose flavonoid 3-O-glucosyltran... 55 2e-06 XP_017423634.1 PREDICTED: scopoletin glucosyltransferase-like [V... 55 2e-06 XP_013458220.1 UDP-glucosyltransferase family protein [Medicago ... 55 2e-06 XP_004508345.1 PREDICTED: scopoletin glucosyltransferase [Cicer ... 55 2e-06 XP_013441779.1 UDP-glucosyltransferase family protein [Medicago ... 55 2e-06 GAU41612.1 hypothetical protein TSUD_196820 [Trifolium subterran... 54 3e-06 GAU41614.1 hypothetical protein TSUD_196840 [Trifolium subterran... 54 3e-06 XP_004508344.1 PREDICTED: UDP-glucose flavonoid 3-O-glucosyltran... 54 4e-06 XP_013451824.1 UDP-glucosyltransferase family protein [Medicago ... 54 4e-06 KYP58165.1 Cytokinin-O-glucosyltransferase 3 [Cajanus cajan] 54 5e-06 XP_014507079.1 PREDICTED: scopoletin glucosyltransferase-like [V... 54 5e-06 >BAC78438.1 isoflavonoid glucosyltransferase [Glycyrrhiza echinata] Length = 482 Score = 71.2 bits (173), Expect = 3e-12 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = +1 Query: 223 MDLEREEIEKPLKLYFIHYLAAGHMIPLCDIATLF 327 MDLERE EKPLKLYFIHYLAAGHMIPLCDIATLF Sbjct: 1 MDLEREGTEKPLKLYFIHYLAAGHMIPLCDIATLF 35 >KRH02148.1 hypothetical protein GLYMA_17G019400 [Glycine max] Length = 473 Score = 57.0 bits (136), Expect = 3e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 241 EIEKPLKLYFIHYLAAGHMIPLCDIATLF 327 E KPLKLYFIH+LAAGHMIPLCD+ATLF Sbjct: 2 EERKPLKLYFIHFLAAGHMIPLCDMATLF 30 >XP_006600323.1 PREDICTED: scopoletin glucosyltransferase-like [Glycine max] Length = 500 Score = 57.0 bits (136), Expect = 3e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 241 EIEKPLKLYFIHYLAAGHMIPLCDIATLF 327 E KPLKLYFIH+LAAGHMIPLCD+ATLF Sbjct: 2 EERKPLKLYFIHFLAAGHMIPLCDMATLF 30 >XP_014521976.1 PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like [Vigna radiata var. radiata] Length = 472 Score = 56.6 bits (135), Expect = 4e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 241 EIEKPLKLYFIHYLAAGHMIPLCDIATLF 327 E +PLKLYFIH+LAAGHMIPLCDIATLF Sbjct: 2 EETRPLKLYFIHFLAAGHMIPLCDIATLF 30 >XP_007154186.1 hypothetical protein PHAVU_003G097200g [Phaseolus vulgaris] ESW26180.1 hypothetical protein PHAVU_003G097200g [Phaseolus vulgaris] Length = 473 Score = 56.6 bits (135), Expect = 4e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 241 EIEKPLKLYFIHYLAAGHMIPLCDIATLF 327 E +PLKLYFIH+LAAGHMIPLCDIATLF Sbjct: 2 EETRPLKLYFIHFLAAGHMIPLCDIATLF 30 >KYP58166.1 Anthocyanin 3'-O-beta-glucosyltransferase [Cajanus cajan] Length = 399 Score = 55.5 bits (132), Expect = 1e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 253 PLKLYFIHYLAAGHMIPLCDIATLF 327 PLKLYFIH+LAAGHMIPLCDIATLF Sbjct: 6 PLKLYFIHFLAAGHMIPLCDIATLF 30 >XP_003594819.1 UDP-glucosyltransferase family protein [Medicago truncatula] AES65070.1 UDP-glucosyltransferase family protein [Medicago truncatula] Length = 491 Score = 55.5 bits (132), Expect = 1e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +1 Query: 229 LEREEIEKPLKLYFIHYLAAGHMIPLCDIATLF 327 +E E+E+PLK++FI YLA+GHMIPLCDIAT+F Sbjct: 1 MEGVEVERPLKIHFIPYLASGHMIPLCDIATMF 33 >GAU41620.1 hypothetical protein TSUD_196900 [Trifolium subterraneum] Length = 363 Score = 55.1 bits (131), Expect = 1e-06 Identities = 24/35 (68%), Positives = 31/35 (88%) Frame = +1 Query: 223 MDLEREEIEKPLKLYFIHYLAAGHMIPLCDIATLF 327 M+L+ E+E+PLKL+FI +LA GHMIPLCDIA+LF Sbjct: 1 MELKGVEVERPLKLHFIPFLAPGHMIPLCDIASLF 35 >XP_003612854.1 UDP-glucosyltransferase family protein [Medicago truncatula] AES95812.1 UDP-glucosyltransferase family protein [Medicago truncatula] Length = 487 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/33 (69%), Positives = 30/33 (90%) Frame = +1 Query: 229 LEREEIEKPLKLYFIHYLAAGHMIPLCDIATLF 327 +E E+++PLK++FI YLA+GHMIPLCDIATLF Sbjct: 1 MEGVEVDRPLKIHFIPYLASGHMIPLCDIATLF 33 >XP_017422486.1 PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7-like [Vigna angularis] KOM33589.1 hypothetical protein LR48_Vigan01g314500 [Vigna angularis] BAT77219.1 hypothetical protein VIGAN_01531600 [Vigna angularis var. angularis] Length = 471 Score = 54.7 bits (130), Expect = 2e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +1 Query: 241 EIEKPLKLYFIHYLAAGHMIPLCDIATLF 327 E +PLKLYFIH LAAGHMIPLCDIATLF Sbjct: 2 EETRPLKLYFIHSLAAGHMIPLCDIATLF 30 >XP_017423634.1 PREDICTED: scopoletin glucosyltransferase-like [Vigna angularis] KOM43816.1 hypothetical protein LR48_Vigan05g142100 [Vigna angularis] Length = 472 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 241 EIEKPLKLYFIHYLAAGHMIPLCDIATLF 327 E +PLKL+FIH+LAAGHMIPLCDIATLF Sbjct: 2 EETRPLKLHFIHFLAAGHMIPLCDIATLF 30 >XP_013458220.1 UDP-glucosyltransferase family protein [Medicago truncatula] KEH32251.1 UDP-glucosyltransferase family protein [Medicago truncatula] Length = 474 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 244 IEKPLKLYFIHYLAAGHMIPLCDIATLF 327 ++KPLKLYFI YLAAGHMIPLCDIA+LF Sbjct: 1 MDKPLKLYFIPYLAAGHMIPLCDIASLF 28 >XP_004508345.1 PREDICTED: scopoletin glucosyltransferase [Cicer arietinum] AGU14073.1 UDP-glycosyltransferase [Cicer arietinum] Length = 479 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 244 IEKPLKLYFIHYLAAGHMIPLCDIATLF 327 ++KPLKLYFI YLAAGHMIPLCDIA+LF Sbjct: 1 MDKPLKLYFIPYLAAGHMIPLCDIASLF 28 >XP_013441779.1 UDP-glucosyltransferase family protein [Medicago truncatula] KEH15804.1 UDP-glucosyltransferase family protein [Medicago truncatula] Length = 486 Score = 54.7 bits (130), Expect = 2e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 244 IEKPLKLYFIHYLAAGHMIPLCDIATLF 327 ++KPLKLYFI YLAAGHMIPLCDIA+LF Sbjct: 16 MDKPLKLYFIPYLAAGHMIPLCDIASLF 43 >GAU41612.1 hypothetical protein TSUD_196820 [Trifolium subterraneum] Length = 470 Score = 54.3 bits (129), Expect = 3e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +1 Query: 244 IEKPLKLYFIHYLAAGHMIPLCDIATLF 327 ++KPLKLYFI YLAAGHMIPLCDIA LF Sbjct: 1 MDKPLKLYFIPYLAAGHMIPLCDIAALF 28 >GAU41614.1 hypothetical protein TSUD_196840 [Trifolium subterraneum] Length = 471 Score = 54.3 bits (129), Expect = 3e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = +1 Query: 244 IEKPLKLYFIHYLAAGHMIPLCDIATLF 327 ++KPLKLYFI YLAAGHMIPLCDIA LF Sbjct: 1 MDKPLKLYFIPYLAAGHMIPLCDIAALF 28 >XP_004508344.1 PREDICTED: UDP-glucose flavonoid 3-O-glucosyltransferase 7 [Cicer arietinum] AGU14072.1 UDP-glycosyltransferase [Cicer arietinum] Length = 483 Score = 53.9 bits (128), Expect = 4e-06 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = +1 Query: 223 MDLEREEIEKPLKLYFIHYLAAGHMIPLCDIATLF 327 MDLE EE KPLKLYFI YLA GHMIPLCDIA F Sbjct: 1 MDLEIEE--KPLKLYFIPYLAPGHMIPLCDIAIQF 33 >XP_013451824.1 UDP-glucosyltransferase family protein [Medicago truncatula] KEH25852.1 UDP-glucosyltransferase family protein [Medicago truncatula] Length = 484 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 241 EIEKPLKLYFIHYLAAGHMIPLCDIATLF 327 EIE+PLKL+FI YL+ GHMIPLCDIATLF Sbjct: 5 EIEQPLKLHFIPYLSPGHMIPLCDIATLF 33 >KYP58165.1 Cytokinin-O-glucosyltransferase 3 [Cajanus cajan] Length = 466 Score = 53.5 bits (127), Expect = 5e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +1 Query: 241 EIEKPLKLYFIHYLAAGHMIPLCDIATLF 327 E E+PLKLYFI YLAAGHMIPLCDIA F Sbjct: 4 EAERPLKLYFIPYLAAGHMIPLCDIAQFF 32 >XP_014507079.1 PREDICTED: scopoletin glucosyltransferase-like [Vigna radiata var. radiata] Length = 470 Score = 53.5 bits (127), Expect = 5e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 238 EEIEKPLKLYFIHYLAAGHMIPLCDIATLF 327 EEI +PLKLYFIH LAAGHMIPLCDI TLF Sbjct: 2 EEI-RPLKLYFIHSLAAGHMIPLCDIGTLF 30