BLASTX nr result
ID: Glycyrrhiza29_contig00005471
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00005471 (469 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KCW55427.1 hypothetical protein EUGRSUZ_I01330 [Eucalyptus grandis] 56 2e-07 OMP05967.1 hypothetical protein COLO4_08423 [Corchorus olitorius] 57 1e-06 >KCW55427.1 hypothetical protein EUGRSUZ_I01330 [Eucalyptus grandis] Length = 121 Score = 56.2 bits (134), Expect = 2e-07 Identities = 28/43 (65%), Positives = 29/43 (67%) Frame = +3 Query: 249 FGRAFPYDPLNLFPFFVFLSPRPHNIGPATPPHSAAAIDDDGG 377 FGRAFPYDPLNLFPFFV LSP PH G +A A D D G Sbjct: 28 FGRAFPYDPLNLFPFFVRLSPLPHRTGSG---GAAPAADGDAG 67 >OMP05967.1 hypothetical protein COLO4_08423 [Corchorus olitorius] Length = 840 Score = 57.0 bits (136), Expect = 1e-06 Identities = 33/86 (38%), Positives = 47/86 (54%), Gaps = 2/86 (2%) Frame = +3 Query: 171 IENGNESTHMGNNTTNEPKTLKKLXLFGRAFPYDPLNLFPFFVFLSPRPHNIGP--ATPP 344 ++ + +G +T++ +++ G FPYDPLN FPFFVFLSP PH IG A P Sbjct: 3 LKGRGQGVDLGTSTSSLIRSII-FSFLGLVFPYDPLNHFPFFVFLSPLPHRIGARIAAVP 61 Query: 345 HSAAAIDDDGGPLVNHLAATLLHRCI 422 A + + P++ L AT H CI Sbjct: 62 LGEADVREGHWPVIT-LFATAPHHCI 86