BLASTX nr result
ID: Glycyrrhiza29_contig00001609
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza29_contig00001609 (213 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP39626.1 hypothetical protein KK1_039057 [Cajanus cajan] 51 8e-06 >KYP39626.1 hypothetical protein KK1_039057 [Cajanus cajan] Length = 218 Score = 50.8 bits (120), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -3 Query: 94 TNLKMVMDDDALNGFSPVSTPTINWKSRRRS 2 +N+KMV+DD ALNGFSPVSTP I WKSRRRS Sbjct: 10 SNMKMVIDD-ALNGFSPVSTPRIFWKSRRRS 39