BLASTX nr result
ID: Glycyrrhiza28_contig00041337
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00041337 (347 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024580012.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 61 4e-10 SEC78350.1 AraC-type DNA-binding protein [Bradyrhizobium erythro... 53 8e-06 >WP_024580012.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] OCX27755.1 hypothetical protein QU42_27775 [Bradyrhizobium sp. UASWS1016] Length = 380 Score = 61.2 bits (147), Expect(2) = 4e-10 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = +2 Query: 2 PFNRAFKADTGLTPTEFRRRAAAPSNDRREIAGSG 106 PFNRAFKADTGLTPTEFRRRAAAPSND+ E G Sbjct: 336 PFNRAFKADTGLTPTEFRRRAAAPSNDQVESPAPG 370 Score = 30.0 bits (66), Expect(2) = 4e-10 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +3 Query: 90 KSPAPDENSLLDFRNR 137 +SPAP ENSLLDF NR Sbjct: 365 ESPAPGENSLLDFGNR 380 >SEC78350.1 AraC-type DNA-binding protein [Bradyrhizobium erythrophlei] Length = 367 Score = 53.1 bits (126), Expect = 8e-06 Identities = 28/35 (80%), Positives = 29/35 (82%), Gaps = 1/35 (2%) Frame = +2 Query: 2 PFNRAFKADTGLTPTEFRRRA-AAPSNDRREIAGS 103 PFNRAFKADTGLTPTEFRRRA AA + D EIA S Sbjct: 332 PFNRAFKADTGLTPTEFRRRATAAQTTDAAEIARS 366