BLASTX nr result
ID: Glycyrrhiza28_contig00041247
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00041247 (308 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIV93262.1 hypothetical protein TanjilG_23103 [Lupinus angustifo... 172 4e-48 XP_019424236.1 PREDICTED: pentatricopeptide repeat-containing pr... 172 4e-48 XP_019422727.1 PREDICTED: pentatricopeptide repeat-containing pr... 171 1e-47 XP_017425525.1 PREDICTED: pentatricopeptide repeat-containing pr... 171 1e-47 KOM31832.1 hypothetical protein LR48_Vigan01g138800 [Vigna angul... 171 1e-47 XP_007156522.1 hypothetical protein PHAVU_003G293100g [Phaseolus... 170 2e-47 OIV93245.1 hypothetical protein TanjilG_27424 [Lupinus angustifo... 171 2e-47 GAU31832.1 hypothetical protein TSUD_58330 [Trifolium subterraneum] 168 7e-47 XP_003528496.1 PREDICTED: pentatricopeptide repeat-containing pr... 168 8e-47 XP_014506231.1 PREDICTED: pentatricopeptide repeat-containing pr... 163 7e-45 XP_013456890.1 PPR containing plant-like protein [Medicago trunc... 160 2e-44 XP_003608051.2 PPR containing plant-like protein [Medicago trunc... 160 7e-44 XP_015944423.1 PREDICTED: pentatricopeptide repeat-containing pr... 140 1e-36 XP_016190641.1 PREDICTED: pentatricopeptide repeat-containing pr... 138 5e-36 XP_015957583.1 PREDICTED: pentatricopeptide repeat-containing pr... 136 2e-35 XP_016182089.1 PREDICTED: pentatricopeptide repeat-containing pr... 135 9e-35 XP_018809727.1 PREDICTED: pentatricopeptide repeat-containing pr... 127 6e-32 KDO56123.1 hypothetical protein CISIN_1g005732mg [Citrus sinensis] 125 3e-31 XP_006422125.1 hypothetical protein CICLE_v10007088mg [Citrus cl... 125 3e-31 XP_006490563.1 PREDICTED: pentatricopeptide repeat-containing pr... 125 3e-31 >OIV93262.1 hypothetical protein TanjilG_23103 [Lupinus angustifolius] Length = 726 Score = 172 bits (435), Expect = 4e-48 Identities = 80/102 (78%), Positives = 92/102 (90%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNEFTLDCVIR+CAR+RVL +GK+VHG+CIKN D+D SIGGAL EFYCDC+A+D+AKRV Sbjct: 237 PNEFTLDCVIRVCARMRVLCLGKIVHGICIKNGVDLDNSIGGALIEFYCDCEAIDNAKRV 296 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 YESMGG ACLNVANSLIGGL+ST RIEEAE+IF ELR+ N I Sbjct: 297 YESMGGEACLNVANSLIGGLVSTRRIEEAEVIFNELRDTNYI 338 >XP_019424236.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Lupinus angustifolius] Length = 730 Score = 172 bits (435), Expect = 4e-48 Identities = 80/102 (78%), Positives = 92/102 (90%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNEFTLDCVIR+CAR+RVL +GK+VHG+CIKN D+D SIGGAL EFYCDC+A+D+AKRV Sbjct: 237 PNEFTLDCVIRVCARMRVLCLGKIVHGICIKNGVDLDNSIGGALIEFYCDCEAIDNAKRV 296 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 YESMGG ACLNVANSLIGGL+ST RIEEAE+IF ELR+ N I Sbjct: 297 YESMGGEACLNVANSLIGGLVSTRRIEEAEVIFNELRDTNYI 338 >XP_019422727.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Lupinus angustifolius] Length = 728 Score = 171 bits (432), Expect = 1e-47 Identities = 79/102 (77%), Positives = 91/102 (89%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNEFTLD VIR+CAR+RVLY+GK+VHG+CIKN FD+D SIGGAL EFYCDC+A+DDA++ Sbjct: 239 PNEFTLDSVIRVCARMRVLYLGKIVHGICIKNGFDLDNSIGGALIEFYCDCEAIDDARKA 298 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 YESMGG ACLNVANSLIGGL+S RIEEAE IF ELR+ NSI Sbjct: 299 YESMGGEACLNVANSLIGGLVSARRIEEAEGIFNELRDTNSI 340 >XP_017425525.1 PREDICTED: pentatricopeptide repeat-containing protein At1g28690, mitochondrial-like [Vigna angularis] BAT75059.1 hypothetical protein VIGAN_01286000 [Vigna angularis var. angularis] Length = 728 Score = 171 bits (432), Expect = 1e-47 Identities = 78/102 (76%), Positives = 89/102 (87%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNEFTLDCV+R+CARL VL VG+VVHGLCIK FD D SIGGAL EFYCDC+A+DDAKRV Sbjct: 239 PNEFTLDCVVRVCARLGVLCVGRVVHGLCIKGGFDFDNSIGGALTEFYCDCEAIDDAKRV 298 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 YESMGG CLNVANSLIGGL+S GR+EEAE +F +LR+ NS+ Sbjct: 299 YESMGGETCLNVANSLIGGLVSKGRMEEAEFVFNDLRDTNSV 340 >KOM31832.1 hypothetical protein LR48_Vigan01g138800 [Vigna angularis] Length = 755 Score = 171 bits (432), Expect = 1e-47 Identities = 78/102 (76%), Positives = 89/102 (87%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNEFTLDCV+R+CARL VL VG+VVHGLCIK FD D SIGGAL EFYCDC+A+DDAKRV Sbjct: 239 PNEFTLDCVVRVCARLGVLCVGRVVHGLCIKGGFDFDNSIGGALTEFYCDCEAIDDAKRV 298 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 YESMGG CLNVANSLIGGL+S GR+EEAE +F +LR+ NS+ Sbjct: 299 YESMGGETCLNVANSLIGGLVSKGRMEEAEFVFNDLRDTNSV 340 >XP_007156522.1 hypothetical protein PHAVU_003G293100g [Phaseolus vulgaris] ESW28516.1 hypothetical protein PHAVU_003G293100g [Phaseolus vulgaris] Length = 728 Score = 170 bits (431), Expect = 2e-47 Identities = 80/102 (78%), Positives = 88/102 (86%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNEFTLDCV+R+CARL VL VGKVVHGLCIK FD D SIGGAL EFYCDC+A+DDAKRV Sbjct: 239 PNEFTLDCVLRVCARLGVLCVGKVVHGLCIKGGFDFDNSIGGALTEFYCDCEAIDDAKRV 298 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 YESM G ACLNVANSLIGGL+S GRIEEAE +F ELR+ N + Sbjct: 299 YESMWGEACLNVANSLIGGLVSKGRIEEAEFVFNELRDTNPV 340 >OIV93245.1 hypothetical protein TanjilG_27424 [Lupinus angustifolius] Length = 793 Score = 171 bits (432), Expect = 2e-47 Identities = 79/102 (77%), Positives = 91/102 (89%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNEFTLD VIR+CAR+RVLY+GK+VHG+CIKN FD+D SIGGAL EFYCDC+A+DDA++ Sbjct: 239 PNEFTLDSVIRVCARMRVLYLGKIVHGICIKNGFDLDNSIGGALIEFYCDCEAIDDARKA 298 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 YESMGG ACLNVANSLIGGL+S RIEEAE IF ELR+ NSI Sbjct: 299 YESMGGEACLNVANSLIGGLVSARRIEEAEGIFNELRDTNSI 340 >GAU31832.1 hypothetical protein TSUD_58330 [Trifolium subterraneum] Length = 723 Score = 168 bits (426), Expect = 7e-47 Identities = 82/102 (80%), Positives = 89/102 (87%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNEFTLDCVIRICARL++L VGKVVHGLCIK+ FD D SIGGALAEFYC CDAVDDAKRV Sbjct: 234 PNEFTLDCVIRICARLKILSVGKVVHGLCIKDGFDYDNSIGGALAEFYCVCDAVDDAKRV 293 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 Y+S+ ACLNVANSLIGGLIS GR+EEAE IF+ L EKN I Sbjct: 294 YDSIAAEACLNVANSLIGGLISIGRVEEAERIFHGLTEKNLI 335 >XP_003528496.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Glycine max] KHN31042.1 Pentatricopeptide repeat-containing protein [Glycine soja] KRH50225.1 hypothetical protein GLYMA_07G208800 [Glycine max] Length = 728 Score = 168 bits (426), Expect = 8e-47 Identities = 79/102 (77%), Positives = 87/102 (85%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNEFTLDCV+R+CARL VL GKVVHGLCIK D D SIGGA+ EFYC C+A+DDAKRV Sbjct: 239 PNEFTLDCVVRVCARLGVLRAGKVVHGLCIKGGLDFDNSIGGAVTEFYCGCEAIDDAKRV 298 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 YESMGG A LNVANSLIGGL+S GRIEEAEL+FYELRE N + Sbjct: 299 YESMGGQASLNVANSLIGGLVSKGRIEEAELVFYELRETNPV 340 >XP_014506231.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Vigna radiata var. radiata] Length = 728 Score = 163 bits (412), Expect = 7e-45 Identities = 75/102 (73%), Positives = 86/102 (84%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNEFTLDCV+R+CARL VL VG+VVHGLCIK FD D SIGGAL EFYCDC+A+DDAKRV Sbjct: 239 PNEFTLDCVVRVCARLGVLCVGRVVHGLCIKGGFDFDNSIGGALTEFYCDCEAIDDAKRV 298 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 YESMGG CLNVANSLI GL+S R+EEAE +F +LR+ N + Sbjct: 299 YESMGGETCLNVANSLIAGLVSKVRMEEAEFVFNDLRDTNPV 340 >XP_013456890.1 PPR containing plant-like protein [Medicago truncatula] KEH30921.1 PPR containing plant-like protein [Medicago truncatula] Length = 576 Score = 160 bits (405), Expect = 2e-44 Identities = 76/102 (74%), Positives = 87/102 (85%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNEFTLDCV+R+CARLR+LYVGKVVHGLCIK+ FD D S+ ALAEFYC DAVDDAKRV Sbjct: 235 PNEFTLDCVLRVCARLRILYVGKVVHGLCIKDGFDFDNSVSSALAEFYCVSDAVDDAKRV 294 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 YESM G AC NVA+SLIGGL+S GR++EA +IFY LR+K I Sbjct: 295 YESMVGEACSNVADSLIGGLVSMGRVKEAGMIFYGLRDKTLI 336 >XP_003608051.2 PPR containing plant-like protein [Medicago truncatula] AES90248.2 PPR containing plant-like protein [Medicago truncatula] Length = 724 Score = 160 bits (405), Expect = 7e-44 Identities = 76/102 (74%), Positives = 87/102 (85%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNEFTLDCV+R+CARLR+LYVGKVVHGLCIK+ FD D S+ ALAEFYC DAVDDAKRV Sbjct: 235 PNEFTLDCVLRVCARLRILYVGKVVHGLCIKDGFDFDNSVSSALAEFYCVSDAVDDAKRV 294 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 YESM G AC NVA+SLIGGL+S GR++EA +IFY LR+K I Sbjct: 295 YESMVGEACSNVADSLIGGLVSMGRVKEAGMIFYGLRDKTLI 336 >XP_015944423.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis duranensis] XP_015944424.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis duranensis] XP_015944425.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis duranensis] Length = 726 Score = 140 bits (353), Expect = 1e-36 Identities = 67/102 (65%), Positives = 78/102 (76%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNE TL V+R+C RLR L+ GKVVHG CIK F D +IGG L EFYCDC+A+DDAKRV Sbjct: 234 PNEVTLCTVVRVCTRLRALWQGKVVHGHCIKEGFAFDNAIGGGLIEFYCDCEAIDDAKRV 293 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 +ESM G LN+ NSLIG LIS G+IEEAE+IFY LRE N + Sbjct: 294 HESMRGETYLNLTNSLIGCLISAGKIEEAEMIFYRLRETNHV 335 >XP_016190641.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis ipaensis] XP_016190643.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis ipaensis] XP_016190644.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis ipaensis] XP_016190645.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis ipaensis] XP_016190646.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Arachis ipaensis] Length = 716 Score = 138 bits (348), Expect = 5e-36 Identities = 67/102 (65%), Positives = 77/102 (75%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNE TL V+R+C RLR L+ GKVVHG CIK F D +IGG L EFYCDC+A+ DAKRV Sbjct: 234 PNEVTLCSVVRVCTRLRALWQGKVVHGHCIKEGFAFDNAIGGGLIEFYCDCEAIGDAKRV 293 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 +ESM G LNV N LIG LISTG+IEEAE+IFY LRE N + Sbjct: 294 HESMRGETYLNVTNLLIGCLISTGKIEEAEMIFYRLRETNHV 335 >XP_015957583.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Arachis duranensis] XP_015957584.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Arachis duranensis] Length = 725 Score = 136 bits (343), Expect = 2e-35 Identities = 66/102 (64%), Positives = 76/102 (74%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNE TL V+R+C RLR L+ GKVVHG CIK F D +IGG L EFYCDC+A+ DAKRV Sbjct: 234 PNEVTLCSVVRVCTRLRALWQGKVVHGHCIKEGFAFDNAIGGGLIEFYCDCEAIGDAKRV 293 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 +ESM G LNV N LIG LIS G+IEEAE+IFY LRE N + Sbjct: 294 HESMRGETYLNVTNLLIGCLISAGKIEEAEMIFYRLRETNHV 335 >XP_016182089.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Arachis ipaensis] XP_016182090.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Arachis ipaensis] XP_016182091.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Arachis ipaensis] XP_016182092.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Arachis ipaensis] XP_016182093.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08510-like [Arachis ipaensis] Length = 726 Score = 135 bits (339), Expect = 9e-35 Identities = 65/102 (63%), Positives = 75/102 (73%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNE TL V+R+C RLR L+ GKVVHG C K F D +IGG L FYCDCDA+DDAKRV Sbjct: 234 PNEVTLCTVVRVCTRLRALWQGKVVHGHCTKEGFAFDNAIGGGLIGFYCDCDAIDDAKRV 293 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 +ESM G LN+ N LIG LIS G+IEEAE+IFY LRE N + Sbjct: 294 HESMRGETYLNLTNLLIGCLISAGKIEEAEMIFYRLREMNHV 335 >XP_018809727.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Juglans regia] Length = 713 Score = 127 bits (318), Expect = 6e-32 Identities = 64/102 (62%), Positives = 75/102 (73%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNEFTLDCV+R RL L G+ VHGL IK F+ D SIGGAL E YCDC+A++DAK V Sbjct: 235 PNEFTLDCVLRASGRLGSLSGGRTVHGLLIKYGFEFDHSIGGALIELYCDCEAIEDAKMV 294 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 Y+ MG CLN +NSLIGGLI GR+++AELIF L EKN I Sbjct: 295 YDRMGN-PCLNASNSLIGGLILMGRLKDAELIFNGLLEKNPI 335 >KDO56123.1 hypothetical protein CISIN_1g005732mg [Citrus sinensis] Length = 680 Score = 125 bits (313), Expect = 3e-31 Identities = 65/102 (63%), Positives = 73/102 (71%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNE+T D VIR CARL GKVVHGL IK F+ D+SIGGAL EFYC C+A D A RV Sbjct: 216 PNEYTFDSVIRACARLGAFCEGKVVHGLLIKCGFEFDESIGGALIEFYCGCEAFDGAMRV 275 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 Y+ + CLN +NSLI GLIS GRIE+AELIF L E NSI Sbjct: 276 YDRLEN-PCLNASNSLINGLISMGRIEDAELIFNRLTEANSI 316 Score = 53.9 bits (128), Expect = 3e-06 Identities = 26/86 (30%), Positives = 48/86 (55%) Frame = -3 Query: 303 NEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRVY 124 NE T ++ +CA+L L GK +H L +K+ ++ + +G L FY +C +++AKRV+ Sbjct: 83 NETTFSTILSVCAQLNSLIDGKQIHCLVLKSGYECFEFVGSGLLFFYANCFEIEEAKRVF 142 Query: 123 ESMGGVACLNVANSLIGGLISTGRIE 46 + L+ N L+ L+ G ++ Sbjct: 143 DE------LHEDNELLWSLMLVGYVQ 162 >XP_006422125.1 hypothetical protein CICLE_v10007088mg [Citrus clementina] ESR35365.1 hypothetical protein CICLE_v10007088mg [Citrus clementina] Length = 713 Score = 125 bits (313), Expect = 3e-31 Identities = 65/102 (63%), Positives = 73/102 (71%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNE+T D VIR CARL GKVVHGL IK F+ D+SIGGAL EFYC C+A D A RV Sbjct: 234 PNEYTFDSVIRACARLGAFCEGKVVHGLLIKCGFEFDESIGGALIEFYCGCEAFDGAMRV 293 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 Y+ + CLN +NSLI GLIS GRIE+AELIF L E NSI Sbjct: 294 YDRLEN-PCLNASNSLINGLISMGRIEDAELIFNRLTEANSI 334 Score = 53.9 bits (128), Expect = 3e-06 Identities = 26/86 (30%), Positives = 48/86 (55%) Frame = -3 Query: 303 NEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRVY 124 NE T ++ +CA+L L GK +H L +K+ ++ + +G L FY +C +++AKRV+ Sbjct: 101 NETTFSTILSVCAQLNSLIDGKQIHCLVLKSGYECFEFVGSGLLFFYANCFEIEEAKRVF 160 Query: 123 ESMGGVACLNVANSLIGGLISTGRIE 46 + L+ N L+ L+ G ++ Sbjct: 161 DE------LHEDNELLWSLMLVGYVQ 180 >XP_006490563.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Citrus sinensis] Length = 725 Score = 125 bits (313), Expect = 3e-31 Identities = 65/102 (63%), Positives = 73/102 (71%) Frame = -3 Query: 306 PNEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRV 127 PNE+T D VIR CARL GKVVHGL IK F+ D+SIGGAL EFYC C+A D A RV Sbjct: 246 PNEYTFDSVIRACARLGAFCEGKVVHGLLIKCGFEFDESIGGALIEFYCGCEAFDGAMRV 305 Query: 126 YESMGGVACLNVANSLIGGLISTGRIEEAELIFYELREKNSI 1 Y+ + CLN +NSLI GLIS GRIE+AELIF L E NSI Sbjct: 306 YDRLEN-PCLNASNSLINGLISMGRIEDAELIFNRLTEANSI 346 Score = 53.9 bits (128), Expect = 3e-06 Identities = 26/86 (30%), Positives = 48/86 (55%) Frame = -3 Query: 303 NEFTLDCVIRICARLRVLYVGKVVHGLCIKNSFDVDKSIGGALAEFYCDCDAVDDAKRVY 124 NE T ++ +CA+L L GK +H L +K+ ++ + +G L FY +C +++AKRV+ Sbjct: 113 NETTFSTILSVCAQLNSLIDGKQIHCLVLKSGYECFEFVGSGLLFFYANCFEIEEAKRVF 172 Query: 123 ESMGGVACLNVANSLIGGLISTGRIE 46 + L+ N L+ L+ G ++ Sbjct: 173 DE------LHEDNELLWSLMLVGYVQ 192