BLASTX nr result
ID: Glycyrrhiza28_contig00041179
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00041179 (246 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009161805.1 hypothetical protein HMPREF1120_11008 (mitochondr... 54 6e-08 >XP_009161805.1 hypothetical protein HMPREF1120_11008 (mitochondrion) [Exophiala dermatitidis NIH/UT8656] EHY51766.1 hypothetical protein HMPREF1120_11008 (mitochondrion) [Exophiala dermatitidis NIH/UT8656] Length = 77 Score = 54.3 bits (129), Expect = 6e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +3 Query: 144 IKISNSKAAKGLLV*LEVNCICTVIPISLSQSLR 245 IKISNSKAAKGLLV LEV+ ICT IPISLSQS R Sbjct: 3 IKISNSKAAKGLLVYLEVSSICTAIPISLSQSSR 36