BLASTX nr result
ID: Glycyrrhiza28_contig00041118
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00041118 (310 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABK59352.1 phenylalanine ammonia-lyase, partial [Musa acuminata] 194 8e-62 AAQ15284.1 phenylalanine ammonia-lyase, partial [Pyrus pyrifolia] 194 2e-61 ADP37442.1 phenylalanine ammonia lyase, partial [Dendrobium huos... 194 2e-61 AAC36706.1 phenylalanine ammonia-lyase, partial [Manihot esculenta] 193 2e-61 BAP93823.1 phenylalanine ammonia-lyase homolog, partial [Rubus s... 194 3e-61 BAP93771.1 phenylalanine ammonia-lyase homolog, partial [Rubus g... 194 3e-61 BAP92860.1 phenylalanine ammonia-lyase homolog, partial [Rubus g... 194 4e-61 BAP92822.1 phenylalanine ammonia-lyase homolog, partial [Rubus p... 194 4e-61 BAP92772.1 phenylalanine ammonia-lyase homolog, partial [Rubus p... 194 4e-61 AHE41424.1 phenylalanine ammonia lyase, partial [Scutellaria lat... 192 5e-61 ACK76691.1 phenylalanine ammonia lyase, partial [Pyrus x bretsch... 193 8e-61 ABD77410.1 phenylalanine ammonia lyase, partial [Zingiber offici... 191 2e-60 BAD26880.1 phenylalanine ammonia-lyase, partial [Phyllostachys e... 191 3e-60 AKA28061.1 PAL1, partial [Helianthus annuus] AKA28062.1 PAL1, pa... 190 3e-60 BAP93777.1 phenylalanine ammonia-lyase homolog, partial [Rubus g... 191 3e-60 BAP92851.1 phenylalanine ammonia-lyase homolog, partial [Rubus g... 191 3e-60 AIM39336.1 phenylalanine ammonia-lyase, partial [Begonia cucullata] 189 4e-60 XP_015935722.1 PREDICTED: phenylalanine ammonia-lyase-like [Arac... 202 4e-60 AGO02168.1 phenylalanine ammonia lyase, partial [Nekemias grosse... 193 4e-60 CBI14825.3 unnamed protein product, partial [Vitis vinifera] 190 5e-60 >ABK59352.1 phenylalanine ammonia-lyase, partial [Musa acuminata] Length = 164 Score = 194 bits (493), Expect = 8e-62 Identities = 95/103 (92%), Positives = 98/103 (95%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEVIR STKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 25 QDRYALRTSPQWLGPQIEVIRASTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 84 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+AAIGKL+FAQ SELVNDFYNNGLPSNLSGG PS Sbjct: 85 SMDNTRLAVAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPS 127 >AAQ15284.1 phenylalanine ammonia-lyase, partial [Pyrus pyrifolia] Length = 176 Score = 194 bits (492), Expect = 2e-61 Identities = 94/103 (91%), Positives = 98/103 (95%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEVIR STKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 33 QDRYALRTSPQWLGPQIEVIRFSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 92 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+A+IGKL+FAQ SELVNDFYNNGLPSNLSGG PS Sbjct: 93 SMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPS 135 >ADP37442.1 phenylalanine ammonia lyase, partial [Dendrobium huoshanense] Length = 181 Score = 194 bits (492), Expect = 2e-61 Identities = 94/103 (91%), Positives = 99/103 (96%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEVIR +TKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 39 QDRYALRTSPQWLGPQIEVIRAATKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 98 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+AAIGKL+FAQ+SELVNDFYNNGLPSNLSGG PS Sbjct: 99 SMDNTRLAIAAIGKLMFAQISELVNDFYNNGLPSNLSGGRNPS 141 >AAC36706.1 phenylalanine ammonia-lyase, partial [Manihot esculenta] Length = 173 Score = 193 bits (491), Expect = 2e-61 Identities = 94/103 (91%), Positives = 98/103 (95%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEVIR STKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 32 QDRYALRTSPQWLGPQIEVIRFSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 91 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLALA+IGKL+FAQ SELVNDFYNNGLPSNL+GG PS Sbjct: 92 SMDNTRLALASIGKLMFAQFSELVNDFYNNGLPSNLTGGRNPS 134 >BAP93823.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93824.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] Length = 201 Score = 194 bits (492), Expect = 3e-61 Identities = 94/103 (91%), Positives = 98/103 (95%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEVIR STKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 18 QDRYALRTSPQWLGPQIEVIRFSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 77 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+A+IGKL+FAQ SELVNDFYNNGLPSNLSGG PS Sbjct: 78 SMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPS 120 >BAP93771.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP93772.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP93773.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP93774.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP93775.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP93776.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP93778.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP93779.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93780.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93781.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93782.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93783.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93784.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93785.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93786.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93787.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93788.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93789.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93790.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93791.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93792.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93793.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93794.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93795.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93796.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93797.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93798.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93799.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93800.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93801.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93802.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93803.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93804.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93805.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93806.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93807.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93808.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93809.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93810.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93811.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP93812.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP93813.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP93814.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP93815.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP93816.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP93817.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP93818.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP93819.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93820.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93821.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93822.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93825.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93826.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93827.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93828.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93829.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93830.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93831.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93832.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93833.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93834.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93835.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93836.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93837.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93838.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93839.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93840.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93841.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93842.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93843.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93844.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93845.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93846.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93847.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93848.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93849.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] BAP93850.1 phenylalanine ammonia-lyase homolog, partial [Rubus sp. MM-2014] Length = 201 Score = 194 bits (492), Expect = 3e-61 Identities = 94/103 (91%), Positives = 98/103 (95%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEVIR STKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 18 QDRYALRTSPQWLGPQIEVIRFSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 77 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+A+IGKL+FAQ SELVNDFYNNGLPSNLSGG PS Sbjct: 78 SMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPS 120 >BAP92860.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] Length = 202 Score = 194 bits (492), Expect = 4e-61 Identities = 94/103 (91%), Positives = 98/103 (95%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEVIR STKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 18 QDRYALRTSPQWLGPQIEVIRFSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 77 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+A+IGKL+FAQ SELVNDFYNNGLPSNLSGG PS Sbjct: 78 SMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPS 120 >BAP92822.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92823.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92824.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] Length = 202 Score = 194 bits (492), Expect = 4e-61 Identities = 94/103 (91%), Positives = 98/103 (95%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEVIR STKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 18 QDRYALRTSPQWLGPQIEVIRFSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 77 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+A+IGKL+FAQ SELVNDFYNNGLPSNLSGG PS Sbjct: 78 SMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPS 120 >BAP92772.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92773.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92774.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92775.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92776.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92777.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92778.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92779.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92780.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92781.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92782.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92783.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92784.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92785.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92786.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92787.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92788.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92789.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92790.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92791.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92792.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92793.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92794.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92795.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92796.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92797.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92798.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92799.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92800.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92801.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92802.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92803.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92804.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92805.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92806.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92807.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92808.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92809.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92810.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92811.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92812.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92813.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92814.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92815.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92816.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92817.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92818.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92819.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92820.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92821.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92825.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92826.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92827.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92828.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92829.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92830.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92831.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92832.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92833.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92834.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92835.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92836.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92837.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92838.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92839.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92840.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92841.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92842.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92843.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92844.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92845.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92846.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92847.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92848.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92849.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92850.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92852.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92853.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92854.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92855.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92856.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92857.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92858.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92859.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92861.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92862.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92863.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92864.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92865.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92866.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92867.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92868.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92869.1 phenylalanine ammonia-lyase homolog, partial [Rubus palmatus] BAP92870.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92871.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92873.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92874.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] Length = 202 Score = 194 bits (492), Expect = 4e-61 Identities = 94/103 (91%), Positives = 98/103 (95%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEVIR STKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 18 QDRYALRTSPQWLGPQIEVIRFSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 77 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+A+IGKL+FAQ SELVNDFYNNGLPSNLSGG PS Sbjct: 78 SMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPS 120 >AHE41424.1 phenylalanine ammonia lyase, partial [Scutellaria lateriflora] Length = 167 Score = 192 bits (488), Expect = 5e-61 Identities = 93/103 (90%), Positives = 98/103 (95%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEVIR +TKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 4 QDRYALRTSPQWLGPQIEVIRAATKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 63 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+A+IGKL+FAQ SELVNDFYNNGLPSNLSGG PS Sbjct: 64 SMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPS 106 >ACK76691.1 phenylalanine ammonia lyase, partial [Pyrus x bretschneideri] ACK76692.1 phenylalanine ammonia lyase, partial [Pyrus pyrifolia] Length = 217 Score = 193 bits (491), Expect = 8e-61 Identities = 94/103 (91%), Positives = 98/103 (95%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEVIR STKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 33 QDRYALRTSPQWLGPQIEVIRYSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 92 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+A+IGKL+FAQ SELVNDFYNNGLPSNLSGG PS Sbjct: 93 SMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPS 135 >ABD77410.1 phenylalanine ammonia lyase, partial [Zingiber officinale] Length = 175 Score = 191 bits (485), Expect = 2e-60 Identities = 92/103 (89%), Positives = 98/103 (95%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEV+R +TKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 34 QDRYALRTSPQWLGPQIEVLRAATKSIEREINSVNDNPLIDVARNKALHGGNFQGTPIGV 93 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDN+RLA+AAIGKL+FAQ SELVNDFYNNGLPSNLSGG PS Sbjct: 94 SMDNSRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPS 136 >BAD26880.1 phenylalanine ammonia-lyase, partial [Phyllostachys edulis] Length = 176 Score = 191 bits (484), Expect = 3e-60 Identities = 92/103 (89%), Positives = 97/103 (94%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEVIR +TKSIEREINSVNDNPLIDV R KA+HGGNFQGTP+GV Sbjct: 34 QDRYALRTSPQWLGPQIEVIRFATKSIEREINSVNDNPLIDVSRGKAIHGGNFQGTPIGV 93 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+AAIGKL+FAQ SELVNDFYNNGLPSNLSGG PS Sbjct: 94 SMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPS 136 >AKA28061.1 PAL1, partial [Helianthus annuus] AKA28062.1 PAL1, partial [Helianthus annuus] AKA28063.1 PAL1, partial [Helianthus annuus] AKA28064.1 PAL1, partial [Helianthus annuus] AKA28065.1 PAL1, partial [Helianthus annuus] AKA28066.1 PAL1, partial [Helianthus annuus] AKA28067.1 PAL1, partial [Helianthus annuus] AKA28068.1 PAL1, partial [Helianthus annuus] AKA28069.1 PAL1, partial [Helianthus annuus] AKA28070.1 PAL1, partial [Helianthus annuus] AKA28071.1 PAL1, partial [Helianthus annuus] AKA28072.1 PAL1, partial [Helianthus annuus] AKA28073.1 PAL1, partial [Helianthus annuus] AKA28074.1 PAL1, partial [Helianthus annuus] AKA28075.1 PAL1, partial [Helianthus annuus] AKA28076.1 PAL1, partial [Helianthus annuus] AKA28077.1 PAL1, partial [Helianthus annuus] AKA28078.1 PAL1, partial [Helianthus annuus] AKA28079.1 PAL1, partial [Helianthus annuus] AKA28080.1 PAL1, partial [Helianthus annuus] AKA28081.1 PAL1, partial [Helianthus annuus] AKA28082.1 PAL1, partial [Helianthus annuus] AKA28083.1 PAL1, partial [Helianthus annuus] AKA28084.1 PAL1, partial [Helianthus annuus] AKA28085.1 PAL1, partial [Helianthus annuus] AKA28087.1 PAL1, partial [Helianthus annuus] AKA28088.1 PAL1, partial [Helianthus annuus] AKA28089.1 PAL1, partial [Helianthus argophyllus] Length = 157 Score = 190 bits (482), Expect = 3e-60 Identities = 92/103 (89%), Positives = 97/103 (94%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEVIR +TK IEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 10 QDRYALRTSPQWLGPQIEVIRSATKMIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 69 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+AAIGKL+FAQ SELVNDFYNNGLPSNL+GG PS Sbjct: 70 SMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLTGGRNPS 112 >BAP93777.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] Length = 201 Score = 191 bits (486), Expect = 3e-60 Identities = 93/103 (90%), Positives = 97/103 (94%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQI VIR STKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 18 QDRYALRTSPQWLGPQIXVIRFSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 77 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+A+IGKL+FAQ SELVNDFYNNGLPSNLSGG PS Sbjct: 78 SMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPS 120 >BAP92851.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92872.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92875.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] BAP92876.1 phenylalanine ammonia-lyase homolog, partial [Rubus grayanus] Length = 202 Score = 191 bits (486), Expect = 3e-60 Identities = 93/103 (90%), Positives = 97/103 (94%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQI VIR STKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 18 QDRYALRTSPQWLGPQIXVIRFSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 77 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+A+IGKL+FAQ SELVNDFYNNGLPSNLSGG PS Sbjct: 78 SMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPS 120 >AIM39336.1 phenylalanine ammonia-lyase, partial [Begonia cucullata] Length = 144 Score = 189 bits (480), Expect = 4e-60 Identities = 92/103 (89%), Positives = 96/103 (93%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGP IEVIR STKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 31 QDRYALRTSPQWLGPLIEVIRFSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 90 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+ +IGKL+FAQ SELVNDFYNNGLPSNLSGG PS Sbjct: 91 SMDNTRLAIGSIGKLIFAQFSELVNDFYNNGLPSNLSGGKNPS 133 >XP_015935722.1 PREDICTED: phenylalanine ammonia-lyase-like [Arachis duranensis] Length = 625 Score = 202 bits (515), Expect = 4e-60 Identities = 99/103 (96%), Positives = 101/103 (98%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDV RNKALHGGNFQGTPVGV Sbjct: 251 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPVGV 310 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLALAAIGKL+FAQMSELVN+FYNNGLPSNLSGG CPS Sbjct: 311 SMDNTRLALAAIGKLIFAQMSELVNEFYNNGLPSNLSGGQCPS 353 >AGO02168.1 phenylalanine ammonia lyase, partial [Nekemias grossedentata] Length = 272 Score = 193 bits (491), Expect = 4e-60 Identities = 94/103 (91%), Positives = 98/103 (95%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGPQIEVIR STKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 151 QDRYALRTSPQWLGPQIEVIRTSTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 210 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+A+IGKL+FAQ SELVNDFYNNGLPSNLSGG PS Sbjct: 211 SMDNTRLAIASIGKLMFAQFSELVNDFYNNGLPSNLSGGRNPS 253 >CBI14825.3 unnamed protein product, partial [Vitis vinifera] Length = 185 Score = 190 bits (483), Expect = 5e-60 Identities = 93/103 (90%), Positives = 96/103 (93%) Frame = +2 Query: 2 QDRYALRTSPQWLGPQIEVIRLSTKSIEREINSVNDNPLIDVPRNKALHGGNFQGTPVGV 181 QDRYALRTSPQWLGP IEVIR STKSIEREINSVNDNPLIDV RNKALHGGNFQGTP+GV Sbjct: 55 QDRYALRTSPQWLGPHIEVIRASTKSIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGV 114 Query: 182 SMDNTRLALAAIGKLLFAQMSELVNDFYNNGLPSNLSGGHCPS 310 SMDNTRLA+AAIGKL+FAQ SELVNDFYNNGLPSNLSG PS Sbjct: 115 SMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSGSRNPS 157