BLASTX nr result
ID: Glycyrrhiza28_contig00041115
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00041115 (177 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004513061.1 PREDICTED: arginine--tRNA ligase, cytoplasmic-lik... 110 5e-27 KRH33158.1 hypothetical protein GLYMA_10G102900 [Glycine max] 108 1e-26 KHN32538.1 Arginine--tRNA ligase [Glycine soja] KRH33157.1 hypot... 108 2e-26 XP_003535906.1 PREDICTED: arginine--tRNA ligase, cytoplasmic-lik... 108 3e-26 XP_007152961.1 hypothetical protein PHAVU_004G174700g [Phaseolus... 108 5e-26 GAU22773.1 hypothetical protein TSUD_142110 [Trifolium subterran... 108 5e-26 KYP61388.1 Arginyl-tRNA synthetase [Cajanus cajan] 107 6e-26 XP_013453200.1 cytoplasmic-like arginine-tRNA ligase [Medicago t... 106 2e-25 XP_014619931.1 PREDICTED: arginine--tRNA ligase, chloroplastic/m... 104 9e-25 XP_006572930.1 PREDICTED: arginine--tRNA ligase, cytoplasmic-lik... 104 1e-24 KHN39952.1 Arginine--tRNA ligase, cytoplasmic [Glycine soja] 104 1e-24 XP_014515617.1 PREDICTED: arginine--tRNA ligase, cytoplasmic-lik... 103 2e-24 KYP61386.1 Arginyl-tRNA synthetase, cytoplasmic, partial [Cajanu... 102 4e-24 KOM54173.1 hypothetical protein LR48_Vigan10g006500, partial [Vi... 102 5e-24 XP_017439971.1 PREDICTED: arginine--tRNA ligase, chloroplastic/m... 102 5e-24 XP_014513210.1 PREDICTED: arginine--tRNA ligase, cytoplasmic-lik... 102 5e-24 XP_007152963.1 hypothetical protein PHAVU_004G174900g [Phaseolus... 102 5e-24 XP_003529061.1 PREDICTED: arginine--tRNA ligase, cytoplasmic-lik... 102 5e-24 XP_017440314.1 PREDICTED: arginine--tRNA ligase, cytoplasmic-lik... 102 7e-24 XP_013462060.1 cytoplasmic-like arginine-tRNA ligase [Medicago t... 100 2e-23 >XP_004513061.1 PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Cicer arietinum] Length = 650 Score = 110 bits (276), Expect = 5e-27 Identities = 50/59 (84%), Positives = 56/59 (94%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EE+KRNG I+LDHED+RLLG+HLLQFPEVFEEAC+NL P+VLCEYLYNLAEIFT Sbjct: 548 SGKDIEEVKRNGFIVLDHEDERLLGIHLLQFPEVFEEACTNLLPSVLCEYLYNLAEIFT 606 >KRH33158.1 hypothetical protein GLYMA_10G102900 [Glycine max] Length = 416 Score = 108 bits (270), Expect = 1e-26 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EE+KRNG I+LDHED+R LGLHLLQFPEVFEEAC+NL PN LCEYLYNLAEIFT Sbjct: 314 SGKDIEEVKRNGKIVLDHEDERALGLHLLQFPEVFEEACTNLLPNFLCEYLYNLAEIFT 372 >KHN32538.1 Arginine--tRNA ligase [Glycine soja] KRH33157.1 hypothetical protein GLYMA_10G102900 [Glycine max] Length = 479 Score = 108 bits (270), Expect = 2e-26 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EE+KRNG I+LDHED+R LGLHLLQFPEVFEEAC+NL PN LCEYLYNLAEIFT Sbjct: 377 SGKDIEEVKRNGKIVLDHEDERALGLHLLQFPEVFEEACTNLLPNFLCEYLYNLAEIFT 435 >XP_003535906.1 PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Glycine max] Length = 651 Score = 108 bits (270), Expect = 3e-26 Identities = 50/59 (84%), Positives = 54/59 (91%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EE+KRNG I+LDHED+R LGLHLLQFPEVFEEAC+NL PN LCEYLYNLAEIFT Sbjct: 549 SGKDIEEVKRNGKIVLDHEDERALGLHLLQFPEVFEEACTNLLPNFLCEYLYNLAEIFT 607 >XP_007152961.1 hypothetical protein PHAVU_004G174700g [Phaseolus vulgaris] ESW24955.1 hypothetical protein PHAVU_004G174700g [Phaseolus vulgaris] Length = 653 Score = 108 bits (269), Expect = 5e-26 Identities = 49/59 (83%), Positives = 55/59 (93%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SG+D EE+KRNG I+LDHED+R LGLHLLQFPEVFEEAC+NL PN+LCEYLYNLAEIFT Sbjct: 551 SGRDIEEVKRNGKIVLDHEDERALGLHLLQFPEVFEEACTNLLPNLLCEYLYNLAEIFT 609 >GAU22773.1 hypothetical protein TSUD_142110 [Trifolium subterraneum] Length = 672 Score = 108 bits (269), Expect = 5e-26 Identities = 50/59 (84%), Positives = 55/59 (93%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EEIK+NG I+LDHED+RLLGLHLLQFPEVFEEACSNL P+VLC+YLY LAEIFT Sbjct: 570 SGKDIEEIKKNGYIVLDHEDERLLGLHLLQFPEVFEEACSNLLPSVLCDYLYTLAEIFT 628 >KYP61388.1 Arginyl-tRNA synthetase [Cajanus cajan] Length = 677 Score = 107 bits (268), Expect = 6e-26 Identities = 49/59 (83%), Positives = 55/59 (93%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EEIKRNG ++LDHED+R LGLHLLQFPEVFEEAC+NL PN+LCEYLYNLAEIF+ Sbjct: 575 SGKDIEEIKRNGKVVLDHEDERALGLHLLQFPEVFEEACTNLLPNLLCEYLYNLAEIFS 633 >XP_013453200.1 cytoplasmic-like arginine-tRNA ligase [Medicago truncatula] KEH27228.1 cytoplasmic-like arginine-tRNA ligase [Medicago truncatula] Length = 659 Score = 106 bits (264), Expect = 2e-25 Identities = 47/59 (79%), Positives = 55/59 (93%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EE+K+NG+I+LDHE +RLLGLH+LQFPEVFEEACSNL P+VLC+YLY LAEIFT Sbjct: 557 SGKDIEEVKKNGVIVLDHESERLLGLHILQFPEVFEEACSNLLPSVLCDYLYTLAEIFT 615 >XP_014619931.1 PREDICTED: arginine--tRNA ligase, chloroplastic/mitochondrial-like isoform X2 [Glycine max] KRH74210.1 hypothetical protein GLYMA_01G006100 [Glycine max] Length = 539 Score = 104 bits (259), Expect = 9e-25 Identities = 48/59 (81%), Positives = 53/59 (89%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EE+KRNG I+LDHED+R LGLHLLQFPEV+EEAC+ L PN LCEYLYNLAEIFT Sbjct: 437 SGKDIEEVKRNGKIVLDHEDERALGLHLLQFPEVYEEACTYLLPNFLCEYLYNLAEIFT 495 >XP_006572930.1 PREDICTED: arginine--tRNA ligase, cytoplasmic-like isoform X1 [Glycine max] KRH74209.1 hypothetical protein GLYMA_01G006100 [Glycine max] Length = 651 Score = 104 bits (259), Expect = 1e-24 Identities = 48/59 (81%), Positives = 53/59 (89%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EE+KRNG I+LDHED+R LGLHLLQFPEV+EEAC+ L PN LCEYLYNLAEIFT Sbjct: 549 SGKDIEEVKRNGKIVLDHEDERALGLHLLQFPEVYEEACTYLLPNFLCEYLYNLAEIFT 607 >KHN39952.1 Arginine--tRNA ligase, cytoplasmic [Glycine soja] Length = 655 Score = 104 bits (259), Expect = 1e-24 Identities = 48/59 (81%), Positives = 53/59 (89%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EE+KRNG I+LDHED+R LGLHLLQFPEV+EEAC+ L PN LCEYLYNLAEIFT Sbjct: 553 SGKDIEEVKRNGKIVLDHEDERALGLHLLQFPEVYEEACTYLLPNFLCEYLYNLAEIFT 611 >XP_014515617.1 PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Vigna radiata var. radiata] Length = 651 Score = 103 bits (257), Expect = 2e-24 Identities = 47/59 (79%), Positives = 54/59 (91%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SG+D EE+KRNG I+LD ED+R LGLHLLQFPEVFEEAC+NL PN+LCEYLYNL+EIFT Sbjct: 549 SGRDIEEVKRNGEIVLDSEDERALGLHLLQFPEVFEEACTNLLPNLLCEYLYNLSEIFT 607 >KYP61386.1 Arginyl-tRNA synthetase, cytoplasmic, partial [Cajanus cajan] Length = 623 Score = 102 bits (255), Expect = 4e-24 Identities = 47/59 (79%), Positives = 53/59 (89%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EE+KRNG I+L+HED+R LGLHL+QFPEVFEE+ SNL PNVLCEYLYNL EIFT Sbjct: 521 SGKDIEELKRNGSIVLEHEDERALGLHLIQFPEVFEESLSNLLPNVLCEYLYNLTEIFT 579 >KOM54173.1 hypothetical protein LR48_Vigan10g006500, partial [Vigna angularis] Length = 592 Score = 102 bits (254), Expect = 5e-24 Identities = 47/59 (79%), Positives = 53/59 (89%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EEIK+NG I+LDHED+R LGLHL+QFPEVFEE+ +NL PNVLCEYLYNL EIFT Sbjct: 490 SGKDIEEIKKNGKIVLDHEDERALGLHLIQFPEVFEESLTNLLPNVLCEYLYNLTEIFT 548 >XP_017439971.1 PREDICTED: arginine--tRNA ligase, chloroplastic/mitochondrial-like [Vigna angularis] BAU02948.1 hypothetical protein VIGAN_11254500 [Vigna angularis var. angularis] Length = 596 Score = 102 bits (254), Expect = 5e-24 Identities = 47/59 (79%), Positives = 53/59 (89%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EEIK+NG I+LDHED+R LGLHL+QFPEVFEE+ +NL PNVLCEYLYNL EIFT Sbjct: 494 SGKDIEEIKKNGKIVLDHEDERALGLHLIQFPEVFEESLTNLLPNVLCEYLYNLTEIFT 552 >XP_014513210.1 PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Vigna radiata var. radiata] Length = 596 Score = 102 bits (254), Expect = 5e-24 Identities = 47/59 (79%), Positives = 53/59 (89%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EEIK+NG I+LDHED+R LGLHL+QFPEVFEE+ +NL PNVLCEYLYNL EIFT Sbjct: 494 SGKDIEEIKKNGKIVLDHEDERALGLHLIQFPEVFEESLTNLLPNVLCEYLYNLTEIFT 552 >XP_007152963.1 hypothetical protein PHAVU_004G174900g [Phaseolus vulgaris] ESW24957.1 hypothetical protein PHAVU_004G174900g [Phaseolus vulgaris] Length = 596 Score = 102 bits (254), Expect = 5e-24 Identities = 47/59 (79%), Positives = 53/59 (89%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EEIK+NG I+LDHED+R LGLHL+QFPEVFEE+ +NL PNVLCEYLYNL EIFT Sbjct: 494 SGKDIEEIKKNGKIVLDHEDERALGLHLIQFPEVFEESLTNLLPNVLCEYLYNLTEIFT 552 >XP_003529061.1 PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Glycine max] KHN14253.1 Arginine--tRNA ligase, cytoplasmic [Glycine soja] KRH49000.1 hypothetical protein GLYMA_07G125400 [Glycine max] Length = 597 Score = 102 bits (254), Expect = 5e-24 Identities = 47/59 (79%), Positives = 53/59 (89%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EEIK+NG I+LDHED+R LGLHL+QFPEVFEE+ +NL PNVLCEYLYNL EIFT Sbjct: 495 SGKDIEEIKKNGNIVLDHEDERALGLHLIQFPEVFEESLTNLLPNVLCEYLYNLTEIFT 553 >XP_017440314.1 PREDICTED: arginine--tRNA ligase, cytoplasmic-like [Vigna angularis] KOM54170.1 hypothetical protein LR48_Vigan10g006200 [Vigna angularis] BAU02951.1 hypothetical protein VIGAN_11254800 [Vigna angularis var. angularis] Length = 651 Score = 102 bits (253), Expect = 7e-24 Identities = 46/59 (77%), Positives = 53/59 (89%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SG+D EE+KRNG I+LD ED+R LGLHLLQFPEVFEE C+NL PN+LCEYLYNL+EIFT Sbjct: 549 SGRDIEEVKRNGKIVLDSEDERALGLHLLQFPEVFEETCTNLLPNLLCEYLYNLSEIFT 607 >XP_013462060.1 cytoplasmic-like arginine-tRNA ligase [Medicago truncatula] KEH36095.1 cytoplasmic-like arginine-tRNA ligase [Medicago truncatula] Length = 596 Score = 100 bits (250), Expect = 2e-23 Identities = 46/59 (77%), Positives = 53/59 (89%) Frame = +1 Query: 1 SGKDTEEIKRNGIIILDHEDKRLLGLHLLQFPEVFEEACSNLSPNVLCEYLYNLAEIFT 177 SGKD EE+K+NG ++L+HED+R LGLHLLQF EVF E+CSNL PNVLCEYLYNLAEIFT Sbjct: 494 SGKDIEELKKNGNLVLEHEDERTLGLHLLQFTEVFVESCSNLLPNVLCEYLYNLAEIFT 552