BLASTX nr result
ID: Glycyrrhiza28_contig00041110
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00041110 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_059401299.1 hypothetical protein [Alicycliphilus sp. B1] 52 7e-06 GAO23992.1 lipase-activating protease [Alicycliphilus sp. B1] 52 7e-06 >WP_059401299.1 hypothetical protein [Alicycliphilus sp. B1] Length = 495 Score = 52.4 bits (124), Expect = 7e-06 Identities = 31/78 (39%), Positives = 43/78 (55%), Gaps = 8/78 (10%) Frame = -1 Query: 212 TIIVDLNSAYPGGVTRARERVLDLLAFVALGQAQ-----AAERVTG---LRTLAPRHLRE 57 ++I+DLN YPGG+ AR+R+ DLL V + A ++ L LAP LR Sbjct: 32 SLIIDLNLGYPGGLAMARQRLFDLLVRVGYDLPEDMTPPAVPKIDNAPLLDRLAPSRLRG 91 Query: 56 ISNQYLIVHLTPEHIGKL 3 +S QY+ LTPE I +L Sbjct: 92 LSGQYVFAWLTPEQIKRL 109 >GAO23992.1 lipase-activating protease [Alicycliphilus sp. B1] Length = 631 Score = 52.4 bits (124), Expect = 7e-06 Identities = 31/78 (39%), Positives = 43/78 (55%), Gaps = 8/78 (10%) Frame = -1 Query: 212 TIIVDLNSAYPGGVTRARERVLDLLAFVALGQAQ-----AAERVTG---LRTLAPRHLRE 57 ++I+DLN YPGG+ AR+R+ DLL V + A ++ L LAP LR Sbjct: 168 SLIIDLNLGYPGGLAMARQRLFDLLVRVGYDLPEDMTPPAVPKIDNAPLLDRLAPSRLRG 227 Query: 56 ISNQYLIVHLTPEHIGKL 3 +S QY+ LTPE I +L Sbjct: 228 LSGQYVFAWLTPEQIKRL 245