BLASTX nr result
ID: Glycyrrhiza28_contig00041050
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00041050 (250 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SFM08469.1 hypothetical protein SAMN04488125_1494 [Methylobacter... 106 5e-25 WP_012751977.1 hypothetical protein [Methylobacterium extorquens... 103 3e-24 >SFM08469.1 hypothetical protein SAMN04488125_1494 [Methylobacterium salsuginis] Length = 528 Score = 106 bits (264), Expect = 5e-25 Identities = 49/77 (63%), Positives = 62/77 (80%) Frame = +3 Query: 3 LVQLSGRPGVPGTPGQGFFCRVEGSDSASLAVLRTVMPPYGIVRVSAPGAETVLLQANPM 182 LVQLSGR G+PGTPGQGFFCRVE D+ S+AVLRTV PP+ IV V+AP E +L++ P+ Sbjct: 307 LVQLSGRLGMPGTPGQGFFCRVERHDAPSVAVLRTVTPPHDIVHVTAPDTEEFVLESRPL 366 Query: 183 MARIVFAPCQVAMASDR 233 +ARIVF PC++ + SDR Sbjct: 367 LARIVFGPCRITVPSDR 383 >WP_012751977.1 hypothetical protein [Methylobacterium extorquens] ACS38039.1 hypothetical protein; putative exported protein; one putative TM helix; putative F0F1-type ATP synthase subunit b COG domain; putative Chromosome segregation ATPases COG domain [Methylobacterium extorquens AM1] Length = 530 Score = 103 bits (258), Expect = 3e-24 Identities = 47/72 (65%), Positives = 60/72 (83%) Frame = +3 Query: 3 LVQLSGRPGVPGTPGQGFFCRVEGSDSASLAVLRTVMPPYGIVRVSAPGAETVLLQANPM 182 +V LSGR G GTPGQGFFCRV+G+D+ASLAVLRTV PPYGI+ V+AP A+ LL +NP+ Sbjct: 312 MVHLSGRLGSSGTPGQGFFCRVDGADTASLAVLRTVTPPYGIIHVTAPRADEYLLNSNPL 371 Query: 183 MARIVFAPCQVA 218 RIVF+PC+++ Sbjct: 372 RIRIVFSPCRIS 383