BLASTX nr result
ID: Glycyrrhiza28_contig00041046
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00041046 (211 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013460423.1 DUF247 domain protein [Medicago truncatula] KEH34... 60 6e-09 GAU18675.1 hypothetical protein TSUD_125080 [Trifolium subterran... 55 4e-07 XP_013442893.1 DUF247 domain protein [Medicago truncatula] KEH16... 55 4e-07 KYP33459.1 hypothetical protein KK1_045675 [Cajanus cajan] 53 2e-06 KYP33465.1 hypothetical protein KK1_045681 [Cajanus cajan] 53 2e-06 XP_014624855.1 PREDICTED: UPF0481 protein At3g47200-like [Glycin... 52 4e-06 KYP34416.1 hypothetical protein KK1_044625 [Cajanus cajan] 50 8e-06 >XP_013460423.1 DUF247 domain protein [Medicago truncatula] KEH34456.1 DUF247 domain protein [Medicago truncatula] Length = 474 Score = 60.1 bits (144), Expect = 6e-09 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 210 RLHKFLGRGYNFAISVVTFLTLVQAVYAIVAYHFPR 103 + H+FL RGYNFA ++VTFLT+VQ YAI+AYHFPR Sbjct: 439 KFHEFLKRGYNFAATIVTFLTVVQTCYAIIAYHFPR 474 >GAU18675.1 hypothetical protein TSUD_125080 [Trifolium subterraneum] Length = 478 Score = 55.1 bits (131), Expect = 4e-07 Identities = 23/35 (65%), Positives = 29/35 (82%) Frame = -2 Query: 210 RLHKFLGRGYNFAISVVTFLTLVQAVYAIVAYHFP 106 R +KFL RGYN A ++VTFLT+VQ YA++AYHFP Sbjct: 443 RFYKFLKRGYNLAAAIVTFLTVVQTCYAVLAYHFP 477 >XP_013442893.1 DUF247 domain protein [Medicago truncatula] KEH16918.1 DUF247 domain protein [Medicago truncatula] Length = 483 Score = 55.1 bits (131), Expect = 4e-07 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -2 Query: 207 LHKFLGRGYNFAISVVTFLTLVQAVYAIVAYHFP 106 ++KFL RGYNFA ++VTFLT+VQ Y I+AYHFP Sbjct: 447 VYKFLKRGYNFAFTLVTFLTVVQTCYTIIAYHFP 480 >KYP33459.1 hypothetical protein KK1_045675 [Cajanus cajan] Length = 283 Score = 52.8 bits (125), Expect = 2e-06 Identities = 21/36 (58%), Positives = 30/36 (83%) Frame = -2 Query: 207 LHKFLGRGYNFAISVVTFLTLVQAVYAIVAYHFPRK 100 L+KFL RGYNFA +++T LT +Q YAI++YH+P+K Sbjct: 247 LNKFLRRGYNFAAALITLLTAIQTCYAILSYHYPKK 282 >KYP33465.1 hypothetical protein KK1_045681 [Cajanus cajan] Length = 405 Score = 52.8 bits (125), Expect = 2e-06 Identities = 21/36 (58%), Positives = 30/36 (83%) Frame = -2 Query: 207 LHKFLGRGYNFAISVVTFLTLVQAVYAIVAYHFPRK 100 L+KFL RGYNFA +++T LT +Q YAI++YH+P+K Sbjct: 369 LNKFLRRGYNFAAALITLLTAIQTCYAILSYHYPKK 404 >XP_014624855.1 PREDICTED: UPF0481 protein At3g47200-like [Glycine max] KHN12817.1 UPF0481 protein [Glycine soja] KRH05625.1 hypothetical protein GLYMA_17G238300 [Glycine max] Length = 507 Score = 52.0 bits (123), Expect = 4e-06 Identities = 21/36 (58%), Positives = 29/36 (80%) Frame = -2 Query: 207 LHKFLGRGYNFAISVVTFLTLVQAVYAIVAYHFPRK 100 L KFL RGYNFA +++T LT+VQ YA++AYH+P + Sbjct: 455 LQKFLRRGYNFAAALITLLTVVQTCYAVLAYHYPHE 490 >KYP34416.1 hypothetical protein KK1_044625 [Cajanus cajan] Length = 157 Score = 50.1 bits (118), Expect = 8e-06 Identities = 19/35 (54%), Positives = 29/35 (82%) Frame = -2 Query: 207 LHKFLGRGYNFAISVVTFLTLVQAVYAIVAYHFPR 103 L+KFL RGYNFA +++T LT++Q Y I++YH+P+ Sbjct: 121 LNKFLRRGYNFAAALITLLTVIQTCYTILSYHYPK 155