BLASTX nr result
ID: Glycyrrhiza28_contig00040830
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00040830 (343 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_024578484.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 122 1e-34 WP_050631868.1 hypothetical protein [Bradyrhizobium viridifuturi] 110 6e-30 WP_076864790.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] 92 3e-22 SDC73701.1 hypothetical protein SAMN05216337_1004326 [Bradyrhizo... 88 8e-21 WP_018319277.1 hypothetical protein [Bradyrhizobium sp. WSM2793] 62 9e-11 WP_025032444.1 hypothetical protein [Bradyrhizobium sp. DOA9] GA... 60 9e-10 SDD92107.1 hypothetical protein SAMN05216337_101744 [Bradyrhizob... 58 6e-08 >WP_024578484.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] KIU46019.1 hypothetical protein QU41_24640 [Bradyrhizobium elkanii] OCX26943.1 hypothetical protein QU42_29795 [Bradyrhizobium sp. UASWS1016] Length = 63 Score = 122 bits (307), Expect = 1e-34 Identities = 59/63 (93%), Positives = 61/63 (96%) Frame = -2 Query: 267 MGTSIGDTASTILSITLFVLGFVTTFLWGWPRVTRLDEDVEIFKMVGIGLIVFFWIAVTF 88 MGTSIGDTASTILSITLFVLGFVTT LWGWP +TRLDEDV+IFKMVGIGLIVFFWIAVTF Sbjct: 1 MGTSIGDTASTILSITLFVLGFVTTILWGWPPITRLDEDVQIFKMVGIGLIVFFWIAVTF 60 Query: 87 RLI 79 RLI Sbjct: 61 RLI 63 >WP_050631868.1 hypothetical protein [Bradyrhizobium viridifuturi] Length = 63 Score = 110 bits (276), Expect = 6e-30 Identities = 55/63 (87%), Positives = 58/63 (92%) Frame = -2 Query: 267 MGTSIGDTASTILSITLFVLGFVTTFLWGWPRVTRLDEDVEIFKMVGIGLIVFFWIAVTF 88 MGTSIGDTASTILSITLFVLGFV T LWG P +TRL EDVEIFK+VGIGLIVFFWIA+TF Sbjct: 1 MGTSIGDTASTILSITLFVLGFVITVLWGPPSLTRLSEDVEIFKVVGIGLIVFFWIAITF 60 Query: 87 RLI 79 RLI Sbjct: 61 RLI 63 >WP_076864790.1 hypothetical protein [Bradyrhizobium sp. SEMIA 6399] Length = 64 Score = 91.7 bits (226), Expect = 3e-22 Identities = 49/65 (75%), Positives = 54/65 (83%), Gaps = 2/65 (3%) Frame = -2 Query: 267 MGTSIGDTASTILSITLFVLGFVTTFLWGWPRVTRLDEDVE--IFKMVGIGLIVFFWIAV 94 MG SIGDTASTILSITLFVLGFV T LWG P + +DVE IFK+VGIGLIVFFWIA+ Sbjct: 1 MGASIGDTASTILSITLFVLGFVVTVLWG-PSLQWAGDDVEAYIFKLVGIGLIVFFWIAI 59 Query: 93 TFRLI 79 TF+LI Sbjct: 60 TFKLI 64 >SDC73701.1 hypothetical protein SAMN05216337_1004326 [Bradyrhizobium sp. R5] Length = 63 Score = 87.8 bits (216), Expect = 8e-21 Identities = 48/63 (76%), Positives = 50/63 (79%) Frame = -2 Query: 267 MGTSIGDTASTILSITLFVLGFVTTFLWGWPRVTRLDEDVEIFKMVGIGLIVFFWIAVTF 88 MGTSIGDTASTILSITLFVLGFVTT LW DE IFKMVGIGLIVFF +A+TF Sbjct: 1 MGTSIGDTASTILSITLFVLGFVTTVLWEPSFAWLGDEAPYIFKMVGIGLIVFFLVAITF 60 Query: 87 RLI 79 RLI Sbjct: 61 RLI 63 >WP_018319277.1 hypothetical protein [Bradyrhizobium sp. WSM2793] Length = 65 Score = 62.4 bits (150), Expect = 9e-11 Identities = 37/60 (61%), Positives = 40/60 (66%), Gaps = 3/60 (5%) Frame = -2 Query: 249 DTASTILSITLFVLGFVTTFLWGWPRVTRLDEDVE---IFKMVGIGLIVFFWIAVTFRLI 79 DT IL IT VLGFV T LWG P L DVE IFK+VGIGL+VFF IA+TF LI Sbjct: 7 DTIYVILLITTLVLGFVATVLWG-PDFEWLGRDVEAAYIFKLVGIGLVVFFLIAITFSLI 65 >WP_025032444.1 hypothetical protein [Bradyrhizobium sp. DOA9] GAJ31394.1 hypothetical protein BDOA9_0105730 [Bradyrhizobium sp. DOA9] Length = 60 Score = 59.7 bits (143), Expect = 9e-10 Identities = 36/59 (61%), Positives = 39/59 (66%), Gaps = 3/59 (5%) Frame = -2 Query: 246 TASTILSITLFVLGFVTTFLWGWPRVTRLDEDVE---IFKMVGIGLIVFFWIAVTFRLI 79 T IL IT VLGFV T LWG P + DVE IFK+VGIGLIVFF IA+TF LI Sbjct: 3 TVYMILLITTLVLGFVATVLWG-PDFEWFERDVEAAYIFKLVGIGLIVFFLIAITFGLI 60 >SDD92107.1 hypothetical protein SAMN05216337_101744 [Bradyrhizobium sp. R5] Length = 200 Score = 58.2 bits (139), Expect = 6e-08 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 340 RVGNSSSTCRCCRFLNHIQRAECPDGNLD 254 RVGNSSST RCC+FLNHIQ AECPDG+LD Sbjct: 172 RVGNSSSTRRCCKFLNHIQGAECPDGSLD 200