BLASTX nr result
ID: Glycyrrhiza28_contig00040621
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00040621 (236 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_061979372.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] 85 8e-19 WP_034462718.1 hypothetical protein [Afipia sp. P52-10] 80 9e-17 ETR79334.1 hypothetical protein X566_00015 [Afipia sp. P52-10] 80 1e-16 WP_019200151.1 hypothetical protein [Afipia birgiae] 78 5e-16 WP_061979371.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] 74 5e-15 WP_034462605.1 hypothetical protein [Afipia sp. P52-10] ETR79333... 69 5e-13 WP_011993003.1 hypothetical protein [Xanthobacter autotrophicus]... 67 5e-12 WP_019200150.1 hypothetical protein [Afipia birgiae] 65 1e-11 SCB50019.1 Protein of unknown function [Rhizobium multihospitium] 64 4e-11 WP_056301913.1 hypothetical protein [Afipia sp. Root123D2] KQW18... 64 4e-11 WP_044416760.1 hypothetical protein [Rhodopseudomonas palustris]... 64 4e-11 SCB50023.1 Protein of unknown function [Rhizobium multihospitium] 64 1e-10 WP_054211439.1 hypothetical protein [Bosea vaviloviae] KPH76530.... 62 2e-10 WP_011993004.1 hypothetical protein [Xanthobacter autotrophicus]... 62 2e-10 WP_069694191.1 hypothetical protein [Bosea vaviloviae] AOO85008.... 62 2e-10 WP_054211054.1 hypothetical protein [Bosea vaviloviae] KPH78312.... 60 7e-10 WP_045024855.1 MULTISPECIES: hypothetical protein [Rhizobium/Agr... 60 1e-09 WP_045024671.1 MULTISPECIES: hypothetical protein [Agrobacterium... 60 1e-09 WP_065664456.1 hypothetical protein [Agrobacterium sp. B131/95] ... 59 2e-09 SEM60013.1 Protein of unknown function [Bosea lupini] 59 3e-09 >WP_061979372.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] Length = 200 Score = 85.1 bits (209), Expect = 8e-19 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = +1 Query: 1 IVIVYGQDGRHDFRLLDRLTDADIAVKLPVHLRYLPDAIAA 123 IVIVYGQDGRHDFRLLDRLTDADIAVKLPVHLRYLPDAIAA Sbjct: 160 IVIVYGQDGRHDFRLLDRLTDADIAVKLPVHLRYLPDAIAA 200 >WP_034462718.1 hypothetical protein [Afipia sp. P52-10] Length = 200 Score = 79.7 bits (195), Expect = 9e-17 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = +1 Query: 1 IVIVYGQDGRHDFRLLDRLTDADIAVKLPVHLRYLPDAIAA 123 IVIVYGQD HDFRLLDRLTDADIAVKLPVHLRYLPDAIAA Sbjct: 160 IVIVYGQDRSHDFRLLDRLTDADIAVKLPVHLRYLPDAIAA 200 >ETR79334.1 hypothetical protein X566_00015 [Afipia sp. P52-10] Length = 219 Score = 79.7 bits (195), Expect = 1e-16 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = +1 Query: 1 IVIVYGQDGRHDFRLLDRLTDADIAVKLPVHLRYLPDAIAA 123 IVIVYGQD HDFRLLDRLTDADIAVKLPVHLRYLPDAIAA Sbjct: 179 IVIVYGQDRSHDFRLLDRLTDADIAVKLPVHLRYLPDAIAA 219 >WP_019200151.1 hypothetical protein [Afipia birgiae] Length = 200 Score = 77.8 bits (190), Expect = 5e-16 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +1 Query: 1 IVIVYGQDGRHDFRLLDRLTDADIAVKLPVHLRYLPDAIAA 123 IVI+YGQD HDFRLLDRLTDA+IAVKLPVHLRYLPDAIAA Sbjct: 160 IVIIYGQDRSHDFRLLDRLTDAEIAVKLPVHLRYLPDAIAA 200 >WP_061979371.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] Length = 132 Score = 73.6 bits (179), Expect = 5e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 135 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGLA 236 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGLA Sbjct: 1 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGLA 34 >WP_034462605.1 hypothetical protein [Afipia sp. P52-10] ETR79333.1 hypothetical protein X566_00010 [Afipia sp. P52-10] Length = 132 Score = 68.6 bits (166), Expect = 5e-13 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = +3 Query: 135 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGLA 236 MFTFSVTAIHAVITRGRIDA MNGGFR PHYGLA Sbjct: 1 MFTFSVTAIHAVITRGRIDALMNGGFRKPHYGLA 34 >WP_011993003.1 hypothetical protein [Xanthobacter autotrophicus] ABS70099.1 protein of unknown function DUF1419 (plasmid) [Xanthobacter autotrophicus Py2] Length = 200 Score = 67.4 bits (163), Expect = 5e-12 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 1 IVIVYGQDGRHDFRLLDRLTDADIAVKLPVHLRYLPDAIAA 123 IVIVYG+D DF+LLD+LTDA+I KLPVHLRYLPDAIAA Sbjct: 160 IVIVYGRDRGRDFKLLDQLTDAEIGAKLPVHLRYLPDAIAA 200 >WP_019200150.1 hypothetical protein [Afipia birgiae] Length = 133 Score = 65.1 bits (157), Expect = 1e-11 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 135 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGL 233 MFTF VTA+HAVI RGRIDA MNGGFRNPHYGL Sbjct: 1 MFTFPVTAVHAVIARGRIDALMNGGFRNPHYGL 33 >SCB50019.1 Protein of unknown function [Rhizobium multihospitium] Length = 133 Score = 63.5 bits (153), Expect = 4e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 135 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGLA 236 MFTFSVTA+ AVI RGRIDA +NGGFRNPHYGLA Sbjct: 1 MFTFSVTAVRAVIMRGRIDAFLNGGFRNPHYGLA 34 >WP_056301913.1 hypothetical protein [Afipia sp. Root123D2] KQW18118.1 hypothetical protein ASC80_22045 [Afipia sp. Root123D2] Length = 133 Score = 63.5 bits (153), Expect = 4e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 135 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGLA 236 MFTFSVTA+ AVI RGRIDA +NGGFRNPHYGLA Sbjct: 1 MFTFSVTAVRAVIMRGRIDAFLNGGFRNPHYGLA 34 >WP_044416760.1 hypothetical protein [Rhodopseudomonas palustris] KIZ36517.1 hypothetical protein OO17_24625 [Rhodopseudomonas palustris] Length = 133 Score = 63.5 bits (153), Expect = 4e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 135 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGLA 236 MFTFSVTA+ AVI RGRIDA +NGGFRNPHYGLA Sbjct: 1 MFTFSVTAVRAVIMRGRIDAFLNGGFRNPHYGLA 34 >SCB50023.1 Protein of unknown function [Rhizobium multihospitium] Length = 200 Score = 63.9 bits (154), Expect = 1e-10 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +1 Query: 4 VIVYGQDGRHDFRLLDRLTDADIAVKLPVHLRYLPDAIAA 123 VIVYG D R DF++LD+LT+A IA+KLPVHLR+LPDAIAA Sbjct: 161 VIVYGSDQRKDFQVLDQLTEAQIAMKLPVHLRHLPDAIAA 200 >WP_054211439.1 hypothetical protein [Bosea vaviloviae] KPH76530.1 hypothetical protein AE618_23220 [Bosea vaviloviae] Length = 132 Score = 62.0 bits (149), Expect = 2e-10 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 135 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGLA 236 MF+FSVT + AVITRGRIDA +NGGFRNPHYGLA Sbjct: 1 MFSFSVTDVRAVITRGRIDAVLNGGFRNPHYGLA 34 >WP_011993004.1 hypothetical protein [Xanthobacter autotrophicus] ABS70100.1 conserved hypothetical protein (plasmid) [Xanthobacter autotrophicus Py2] Length = 132 Score = 62.0 bits (149), Expect = 2e-10 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 135 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGL 233 MFTFSVT +HAVITRGRIDA NGGFRNP+YGL Sbjct: 1 MFTFSVTDVHAVITRGRIDALANGGFRNPYYGL 33 >WP_069694191.1 hypothetical protein [Bosea vaviloviae] AOO85008.1 hypothetical protein BHK69_30285 (plasmid) [Bosea vaviloviae] Length = 132 Score = 61.6 bits (148), Expect = 2e-10 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 135 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGLA 236 MFTFSVT + AVI RGRIDA +NGGFRNPHYGLA Sbjct: 1 MFTFSVTDVRAVIARGRIDAFLNGGFRNPHYGLA 34 >WP_054211054.1 hypothetical protein [Bosea vaviloviae] KPH78312.1 hypothetical protein AE618_21135 [Bosea vaviloviae] Length = 132 Score = 60.5 bits (145), Expect = 7e-10 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 135 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGL 233 MF+FSVT + AVITRGRIDA +NGGFRNPHYGL Sbjct: 1 MFSFSVTDVRAVITRGRIDAVLNGGFRNPHYGL 33 >WP_045024855.1 MULTISPECIES: hypothetical protein [Rhizobium/Agrobacterium group] KJF65421.1 hypothetical protein RS75_23165 [Rhizobium nepotum 39/7] OBZ97355.1 hypothetical protein ADU59_01015 (plasmid) [Pararhizobium polonicum] Length = 133 Score = 60.1 bits (144), Expect = 1e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 135 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGL 233 MFTFSVT IH V+ RGR+DA +NGGFRNPHYG+ Sbjct: 1 MFTFSVTDIHVVMMRGRLDAHLNGGFRNPHYGM 33 >WP_045024671.1 MULTISPECIES: hypothetical protein [Agrobacterium] GAK72279.1 hypothetical protein RRU01S_24_01560 [Rhizobium rubi NBRC 13261] KJF70143.1 hypothetical protein RP75_28075 [Agrobacterium arsenijevicii] OCJ27245.1 hypothetical protein A6U89_30160 [Agrobacterium sp. B133/95] OCJ40058.1 hypothetical protein A6U91_25365 [Agrobacterium tumefaciens] Length = 133 Score = 60.1 bits (144), Expect = 1e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 135 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGL 233 MFTFSVT IH V+ RGR+DA +NGGFRNPHYG+ Sbjct: 1 MFTFSVTDIHVVMMRGRLDAHLNGGFRNPHYGM 33 >WP_065664456.1 hypothetical protein [Agrobacterium sp. B131/95] OCJ08297.1 hypothetical protein A6U88_24590 [Agrobacterium sp. B131/95] Length = 133 Score = 59.3 bits (142), Expect = 2e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 135 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGL 233 MFTFSVT IH V+ RGR+DA +NGGFRNPHYG+ Sbjct: 1 MFTFSVTDIHVVMMRGRLDAYLNGGFRNPHYGM 33 >SEM60013.1 Protein of unknown function [Bosea lupini] Length = 132 Score = 58.9 bits (141), Expect = 3e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 135 MFTFSVTAIHAVITRGRIDARMNGGFRNPHYGL 233 MFTFSVT +HAVITRGRIDA +NGGF NP+YG+ Sbjct: 1 MFTFSVTHVHAVITRGRIDAFLNGGFCNPYYGI 33