BLASTX nr result
ID: Glycyrrhiza28_contig00040561
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00040561 (262 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SEE44909.1 Glycosyltransferase involved in cell wall bisynthesis... 57 1e-07 >SEE44909.1 Glycosyltransferase involved in cell wall bisynthesis [Bradyrhizobium erythrophlei] Length = 440 Score = 57.0 bits (136), Expect = 1e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 106 VHIEDTLPVIISTPTPTQIRAAGERARPPMNVLFV 2 +HIEDTLPV+IS+ TP + RAAG RARPPMNVLFV Sbjct: 1 MHIEDTLPVMISSMTPIEDRAAGGRARPPMNVLFV 35