BLASTX nr result
ID: Glycyrrhiza28_contig00040466
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00040466 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ODT74118.1 serine recombinase [Pelagibacterium sp. SCN 64-44] 68 4e-11 >ODT74118.1 serine recombinase [Pelagibacterium sp. SCN 64-44] Length = 579 Score = 68.2 bits (165), Expect = 4e-11 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -2 Query: 214 KWRTRHDSNV*PLPSEQFSLPILNARQGTLQCDM 113 KWRTR DSN+ PLPSEQFSLPILNARQGTLQCDM Sbjct: 546 KWRTRQDSNLWPLPSEQFSLPILNARQGTLQCDM 579