BLASTX nr result
ID: Glycyrrhiza28_contig00040417
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00040417 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006577110.1 PREDICTED: MATH domain and coiled-coil domain-con... 74 9e-14 XP_007163026.1 hypothetical protein PHAVU_001G199800g [Phaseolus... 74 9e-14 GAU17581.1 hypothetical protein TSUD_341250 [Trifolium subterran... 74 1e-13 XP_006604682.1 PREDICTED: MATH domain and coiled-coil domain-con... 73 3e-13 KYP71169.1 Ubiquitin carboxyl-terminal hydrolase 12 [Cajanus cajan] 72 8e-13 XP_014495548.1 PREDICTED: MATH domain and coiled-coil domain-con... 70 2e-12 XP_017417688.1 PREDICTED: MATH domain and coiled-coil domain-con... 69 8e-12 XP_015969259.1 PREDICTED: MATH domain and coiled-coil domain-con... 69 1e-11 KOM39537.1 hypothetical protein LR48_Vigan03g291900 [Vigna angul... 67 4e-11 XP_016162925.1 PREDICTED: MATH domain and coiled-coil domain-con... 67 5e-11 KHN43578.1 Ubiquitin carboxyl-terminal hydrolase 12 [Glycine soja] 67 5e-11 XP_006604681.1 PREDICTED: MATH domain and coiled-coil domain-con... 65 1e-10 XP_019444157.1 PREDICTED: MATH domain and coiled-coil domain-con... 63 8e-10 XP_019433214.1 PREDICTED: MATH domain and coiled-coil domain-con... 58 7e-08 XP_014513023.1 PREDICTED: MATH domain and coiled-coil domain-con... 57 2e-07 KOM34054.1 hypothetical protein LR48_Vigan02g020400 [Vigna angul... 57 2e-07 XP_006588898.1 PREDICTED: MATH domain and coiled-coil domain-con... 57 2e-07 KHN19940.1 Ubiquitin carboxyl-terminal hydrolase 12 [Glycine soja] 57 2e-07 XP_007145749.1 hypothetical protein PHAVU_007G264500g [Phaseolus... 56 2e-07 XP_016184536.1 PREDICTED: MATH domain and coiled-coil domain-con... 56 2e-07 >XP_006577110.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like [Glycine max] KHN22572.1 Ubiquitin carboxyl-terminal hydrolase 12 [Glycine soja] KRH68069.1 hypothetical protein GLYMA_03G206100 [Glycine max] KRH68070.1 hypothetical protein GLYMA_03G206100 [Glycine max] Length = 377 Score = 74.3 bits (181), Expect = 9e-14 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +1 Query: 115 MDVQKGISSINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 MD QKG +SI+FETFTWKIENFSKQN K L+SKAFRI GYKWRI L Sbjct: 1 MDNQKG-TSISFETFTWKIENFSKQNTKKLQSKAFRIRGYKWRIRL 45 >XP_007163026.1 hypothetical protein PHAVU_001G199800g [Phaseolus vulgaris] XP_007163027.1 hypothetical protein PHAVU_001G199800g [Phaseolus vulgaris] ESW35020.1 hypothetical protein PHAVU_001G199800g [Phaseolus vulgaris] ESW35021.1 hypothetical protein PHAVU_001G199800g [Phaseolus vulgaris] Length = 381 Score = 74.3 bits (181), Expect = 9e-14 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = +1 Query: 112 RMDVQKGISSINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 RMD QKG + I+FETFTWKIENFSKQN K L+SKAFRI GYKWRI L Sbjct: 6 RMDKQKG-TGIDFETFTWKIENFSKQNRKKLQSKAFRIQGYKWRIRL 51 >GAU17581.1 hypothetical protein TSUD_341250 [Trifolium subterraneum] Length = 681 Score = 73.9 bits (180), Expect = 1e-13 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = +1 Query: 115 MDVQKGISSINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 MD QKG INFE F WKIENFSKQN K+LRSKAF+IG YKWRILL Sbjct: 1 MDNQKG-KGINFEPFVWKIENFSKQNTKNLRSKAFKIGAYKWRILL 45 >XP_006604682.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like [Glycine max] XP_006604683.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like [Glycine max] KRG96335.1 hypothetical protein GLYMA_19G203900 [Glycine max] KRG96336.1 hypothetical protein GLYMA_19G203900 [Glycine max] Length = 379 Score = 72.8 bits (177), Expect = 3e-13 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = +1 Query: 115 MDVQKGISSINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 MD QKG+S I+FETFTWKIENFSKQN K L+SK FRI GYKWRI L Sbjct: 1 MDNQKGMS-ISFETFTWKIENFSKQNTKKLQSKTFRIRGYKWRIRL 45 >KYP71169.1 Ubiquitin carboxyl-terminal hydrolase 12 [Cajanus cajan] Length = 375 Score = 71.6 bits (174), Expect = 8e-13 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +1 Query: 115 MDVQKGISSINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 MD Q G+ I FETFTWKIENFS+QN K+LRSKAFRI GYKWRI L Sbjct: 1 MDDQNGMG-IEFETFTWKIENFSRQNTKNLRSKAFRIRGYKWRICL 45 >XP_014495548.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270 [Vigna radiata var. radiata] XP_014495549.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270 [Vigna radiata var. radiata] Length = 377 Score = 70.5 bits (171), Expect = 2e-12 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = +1 Query: 112 RMDVQKGISSINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 RMD Q+ +SI FETFTWKI+NFSKQN K L+SKAFRI GYKWRI L Sbjct: 6 RMDTQRE-TSIVFETFTWKIQNFSKQNTKKLQSKAFRIRGYKWRIRL 51 >XP_017417688.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like [Vigna angularis] BAT86380.1 hypothetical protein VIGAN_04402100 [Vigna angularis var. angularis] Length = 381 Score = 68.9 bits (167), Expect = 8e-12 Identities = 34/45 (75%), Positives = 38/45 (84%) Frame = +1 Query: 112 RMDVQKGISSINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRI 246 RMD Q+ +SI FETFTWKI+NFSKQN K L+SKAFRI GYKWRI Sbjct: 6 RMDSQRE-TSIFFETFTWKIQNFSKQNTKKLQSKAFRIRGYKWRI 49 >XP_015969259.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58410 [Arachis duranensis] Length = 359 Score = 68.6 bits (166), Expect = 1e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +1 Query: 139 SINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 SI+FETFTWKI+NFSKQNIK+L+SKAFRIG +KWRI L Sbjct: 2 SISFETFTWKIQNFSKQNIKNLQSKAFRIGHHKWRIRL 39 >KOM39537.1 hypothetical protein LR48_Vigan03g291900 [Vigna angularis] Length = 368 Score = 67.0 bits (162), Expect = 4e-11 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +1 Query: 115 MDVQKGISSINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRI 246 MD Q+ +SI FETFTWKI+NFSKQN K L+SKAFRI GYKWRI Sbjct: 1 MDSQRE-TSIFFETFTWKIQNFSKQNTKKLQSKAFRIRGYKWRI 43 >XP_016162925.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58410-like [Arachis ipaensis] Length = 359 Score = 66.6 bits (161), Expect = 5e-11 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +1 Query: 139 SINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 SI+FETFTWKI+NFSKQN K+L+SKAFRIG +KWRI L Sbjct: 2 SISFETFTWKIQNFSKQNTKNLQSKAFRIGHHKWRIRL 39 >KHN43578.1 Ubiquitin carboxyl-terminal hydrolase 12 [Glycine soja] Length = 666 Score = 66.6 bits (161), Expect = 5e-11 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = +1 Query: 112 RMDVQKGISSINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 RMD K SINFETFTWKIENFS+QN L+SKAF+I GYKW+I L Sbjct: 318 RMD-NKRRPSINFETFTWKIENFSRQNTNKLKSKAFQIRGYKWQIRL 363 >XP_006604681.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like [Glycine max] KRG96334.1 hypothetical protein GLYMA_19G203800 [Glycine max] Length = 348 Score = 65.5 bits (158), Expect = 1e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +1 Query: 139 SINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 SINFETFTWKIENFS+QN L+SKAF+I GYKW+I L Sbjct: 8 SINFETFTWKIENFSRQNTNKLKSKAFQIRGYKWQIRL 45 >XP_019444157.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like [Lupinus angustifolius] XP_019444158.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like [Lupinus angustifolius] XP_019444159.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like [Lupinus angustifolius] XP_019444160.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like [Lupinus angustifolius] Length = 355 Score = 63.2 bits (152), Expect = 8e-10 Identities = 31/46 (67%), Positives = 38/46 (82%) Frame = +1 Query: 115 MDVQKGISSINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 M+ Q+G +S+NFETFTWKIENFSKQN +L+SK F+I G KWRI L Sbjct: 1 MENQQG-TSLNFETFTWKIENFSKQNTMNLQSKKFQIQGCKWRIHL 45 >XP_019433214.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like, partial [Lupinus angustifolius] Length = 362 Score = 57.8 bits (138), Expect = 7e-08 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +1 Query: 139 SINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRI 246 SINFETFTWKI++FSK+N SL+SK F+I G KWRI Sbjct: 6 SINFETFTWKIKDFSKRNTMSLQSKEFQIQGCKWRI 41 >XP_014513023.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like [Vigna radiata var. radiata] Length = 361 Score = 56.6 bits (135), Expect = 2e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +1 Query: 139 SINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 S++FE F+WKIE+FSKQNI LRSK F+I G WRIL+ Sbjct: 8 SVDFEKFSWKIEDFSKQNIMKLRSKPFKIRGCTWRILV 45 >KOM34054.1 hypothetical protein LR48_Vigan02g020400 [Vigna angularis] BAT96494.1 hypothetical protein VIGAN_08344400 [Vigna angularis var. angularis] Length = 362 Score = 56.6 bits (135), Expect = 2e-07 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = +1 Query: 139 SINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 S++FE F+WKIE+FSKQNI LRSK F+I G WRIL+ Sbjct: 8 SVDFEKFSWKIEDFSKQNIMKLRSKPFKIRGCTWRILV 45 >XP_006588898.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like isoform X1 [Glycine max] XP_014618281.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like isoform X1 [Glycine max] KRH32747.1 hypothetical protein GLYMA_10G072500 [Glycine max] Length = 366 Score = 56.6 bits (135), Expect = 2e-07 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = +1 Query: 136 SSINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 +S++FE F+WKIE+FSKQN+ LRSK F+I G WRIL+ Sbjct: 7 TSVDFEKFSWKIEDFSKQNVMKLRSKPFKIRGCTWRILV 45 >KHN19940.1 Ubiquitin carboxyl-terminal hydrolase 12 [Glycine soja] Length = 421 Score = 56.6 bits (135), Expect = 2e-07 Identities = 24/39 (61%), Positives = 32/39 (82%) Frame = +1 Query: 136 SSINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 +S++FE F+WKIE+FSKQN+ LRSK F+I G WRIL+ Sbjct: 62 TSVDFEKFSWKIEDFSKQNVMKLRSKPFKIRGCTWRILV 100 >XP_007145749.1 hypothetical protein PHAVU_007G264500g [Phaseolus vulgaris] ESW17743.1 hypothetical protein PHAVU_007G264500g [Phaseolus vulgaris] Length = 359 Score = 56.2 bits (134), Expect = 2e-07 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +1 Query: 139 SINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 S++FE F+WKIE+FSKQN+ LRSK F+I G WRIL+ Sbjct: 8 SVDFEKFSWKIEDFSKQNVMKLRSKPFKIRGCTWRILV 45 >XP_016184536.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like [Arachis ipaensis] XP_016184537.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like [Arachis ipaensis] XP_016184538.1 PREDICTED: MATH domain and coiled-coil domain-containing protein At3g58270-like [Arachis ipaensis] Length = 383 Score = 56.2 bits (134), Expect = 2e-07 Identities = 23/39 (58%), Positives = 33/39 (84%) Frame = +1 Query: 136 SSINFETFTWKIENFSKQNIKSLRSKAFRIGGYKWRILL 252 SS++FE FTWKIE+F+K++I L SKAF+I GY W++L+ Sbjct: 7 SSVDFEIFTWKIEDFTKKDITKLSSKAFKIRGYTWKLLV 45