BLASTX nr result
ID: Glycyrrhiza28_contig00040357
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00040357 (417 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004515902.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 3e-30 XP_013457740.1 PPR containing plant protein [Medicago truncatula... 104 4e-26 XP_013457737.1 PPR containing plant protein [Medicago truncatula... 110 2e-25 XP_016190144.1 PREDICTED: pentatricopeptide repeat-containing pr... 102 2e-22 GAU10023.1 hypothetical protein TSUD_412650 [Trifolium subterran... 100 4e-22 XP_015970183.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 5e-22 XP_004138087.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 2e-17 XP_019185024.1 PREDICTED: pentatricopeptide repeat-containing pr... 87 4e-17 XP_010102683.1 hypothetical protein L484_002057 [Morus notabilis... 86 9e-17 XP_002277390.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 9e-17 XP_008464511.1 PREDICTED: pentatricopeptide repeat-containing pr... 85 1e-16 XP_019464696.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 3e-16 XP_012079974.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 3e-16 XP_015067761.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 4e-16 XP_006344474.1 PREDICTED: pentatricopeptide repeat-containing pr... 84 4e-16 KYP70216.1 hypothetical protein KK1_009427 [Cajanus cajan] 83 6e-16 XP_004236267.1 PREDICTED: pentatricopeptide repeat-containing pr... 83 6e-16 XP_019243615.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 1e-15 XP_016494923.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 1e-15 XP_009782591.1 PREDICTED: pentatricopeptide repeat-containing pr... 82 1e-15 >XP_004515902.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cicer arietinum] Length = 635 Score = 124 bits (310), Expect = 3e-30 Identities = 59/76 (77%), Positives = 67/76 (88%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 +ISKSGTVEDAEKFLKAW KG+P SHSAY HVFESFI+EG+LSEAKDLL KCPS IRRR+ Sbjct: 556 FISKSGTVEDAEKFLKAWRKGNPVSHSAYLHVFESFIREGKLSEAKDLLSKCPSRIRRRR 615 Query: 236 QICDFFAFVENRMAAT 189 Q+ +FF VENR AA+ Sbjct: 616 QVVEFFDSVENRNAAS 631 >XP_013457740.1 PPR containing plant protein [Medicago truncatula] KEH31771.1 PPR containing plant protein [Medicago truncatula] Length = 141 Score = 104 bits (260), Expect = 4e-26 Identities = 50/68 (73%), Positives = 56/68 (82%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 Y+SK GTVEDAEKFLKAW KGSP+SHSAYFHV ESFI G LSE KDLLCK PS R+RK Sbjct: 66 YVSKFGTVEDAEKFLKAWRKGSPRSHSAYFHVLESFI--GELSEVKDLLCKFPSQTRKRK 123 Query: 236 QICDFFAF 213 ++ +FF F Sbjct: 124 KVSEFFCF 131 >XP_013457737.1 PPR containing plant protein [Medicago truncatula] KEH31768.1 PPR containing plant protein [Medicago truncatula] Length = 628 Score = 110 bits (275), Expect = 2e-25 Identities = 52/68 (76%), Positives = 58/68 (85%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 Y+SK GTVEDAEKFLKAW KGSP+SHSAY HV ESFI EGRLSE KDLLCK PS I+R K Sbjct: 551 YVSKFGTVEDAEKFLKAWRKGSPRSHSAYLHVLESFIGEGRLSEVKDLLCKFPSQIKRHK 610 Query: 236 QICDFFAF 213 +I +FF+F Sbjct: 611 KINEFFSF 618 >XP_016190144.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Arachis ipaensis] XP_016190153.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Arachis ipaensis] Length = 643 Score = 102 bits (253), Expect = 2e-22 Identities = 51/75 (68%), Positives = 57/75 (76%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 YISKSGTV+DA KFLKAWS SPQSHSAY HVFESF +EGR S+A+DLL KC HI +RK Sbjct: 564 YISKSGTVDDAVKFLKAWSTESPQSHSAYVHVFESFFREGRESDARDLLSKCRRHITKRK 623 Query: 236 QICDFFAFVENRMAA 192 +I F V N AA Sbjct: 624 EIRALFGSVRNCKAA 638 >GAU10023.1 hypothetical protein TSUD_412650 [Trifolium subterraneum] GAU10021.1 hypothetical protein TSUD_412630 [Trifolium subterraneum] Length = 455 Score = 100 bits (248), Expect = 4e-22 Identities = 49/76 (64%), Positives = 57/76 (75%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 Y+SK GTVEDA KFLKAW KGSP+S SAY HVFESF E RLSE KDL CK P IRRRK Sbjct: 377 YVSKYGTVEDALKFLKAWRKGSPRSDSAYIHVFESFKAEDRLSEVKDLFCKYPLQIRRRK 436 Query: 236 QICDFFAFVENRMAAT 189 ++ + F+ E+ AA+ Sbjct: 437 KVSELFSLCEDSDAAS 452 >XP_015970183.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Arachis duranensis] XP_015970188.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Arachis duranensis] Length = 643 Score = 100 bits (249), Expect = 5e-22 Identities = 50/75 (66%), Positives = 57/75 (76%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 YISKSGTV+DA KFLKAWS SPQSHSAY HVFESF +EGR S+A+DLL KC HI ++K Sbjct: 564 YISKSGTVDDAVKFLKAWSTESPQSHSAYVHVFESFFREGRESDARDLLSKCRRHITKQK 623 Query: 236 QICDFFAFVENRMAA 192 +I F V N AA Sbjct: 624 EIRALFGSVRNCKAA 638 >XP_004138087.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Cucumis sativus] KGN63535.1 hypothetical protein Csa_1G003530 [Cucumis sativus] Length = 632 Score = 87.4 bits (215), Expect = 2e-17 Identities = 43/84 (51%), Positives = 51/84 (60%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 YISK GTV+DA+ FLK S S SAY H+F SF EGR SEAKDLL KCP HIR+ Sbjct: 547 YISKFGTVQDADDFLKVLSSKEYPSVSAYLHIFNSFFNEGRYSEAKDLLFKCPHHIRKHN 606 Query: 236 QICDFFAFVENRMAAT*YLENRPI 165 ++C F E+ A + PI Sbjct: 607 EVCKLFGSAESNTTAATQSSSNPI 630 >XP_019185024.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Ipomoea nil] Length = 633 Score = 86.7 bits (213), Expect = 4e-17 Identities = 45/66 (68%), Positives = 50/66 (75%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 YISK GTVEDA +FLKA SKG P S +AY HV ESF +EGR SEAKDLL KCP HIR+ Sbjct: 562 YISKLGTVEDAMEFLKALSKGYP-SVAAYHHVLESFFEEGRHSEAKDLLYKCPHHIRKHP 620 Query: 236 QICDFF 219 +IC F Sbjct: 621 KICSLF 626 >XP_010102683.1 hypothetical protein L484_002057 [Morus notabilis] EXB93901.1 hypothetical protein L484_002057 [Morus notabilis] Length = 628 Score = 85.5 bits (210), Expect = 9e-17 Identities = 43/74 (58%), Positives = 51/74 (68%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 YISK GTVE+A +FLKA S S SAYFH+FESF +EGR SEAKDLL KCP HIR+ + Sbjct: 553 YISKFGTVEEAAEFLKALSVKKNPSPSAYFHIFESFFREGRHSEAKDLLFKCPHHIRKHR 612 Query: 236 QICDFFAFVENRMA 195 I F ++ A Sbjct: 613 DIAKLFGSTQSSPA 626 >XP_002277390.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Vitis vinifera] Length = 631 Score = 85.5 bits (210), Expect = 9e-17 Identities = 44/74 (59%), Positives = 49/74 (66%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 YISK GTVEDA +FL A S S SAY HVFESF +EGR SEAKDLL KCP HIR+ Sbjct: 554 YISKFGTVEDAGEFLNALSAKKYPSQSAYVHVFESFFQEGRESEAKDLLYKCPHHIRKHP 613 Query: 236 QICDFFAFVENRMA 195 IC F ++ A Sbjct: 614 DICKLFGSAKSEYA 627 >XP_008464511.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Cucumis melo] Length = 623 Score = 85.1 bits (209), Expect = 1e-16 Identities = 40/72 (55%), Positives = 48/72 (66%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 YISK GTV+DA+ FLK S S SAY H+F SF EGR SEAKDLL KCP HIR+ Sbjct: 547 YISKFGTVQDADDFLKVLSSKEYPSVSAYLHIFNSFFNEGRYSEAKDLLFKCPHHIRKHN 606 Query: 236 QICDFFAFVENR 201 ++C F E++ Sbjct: 607 EVCKLFGSAESK 618 >XP_019464696.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Lupinus angustifolius] OIW00303.1 hypothetical protein TanjilG_27554 [Lupinus angustifolius] Length = 620 Score = 84.0 bits (206), Expect = 3e-16 Identities = 42/66 (63%), Positives = 48/66 (72%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 Y+SK GTVEDA +FLKA S S + + YF VFES KEGRLSEAKDLL KCP HIR K Sbjct: 554 YVSKFGTVEDAAEFLKALSVKSYPAEAVYFKVFESLFKEGRLSEAKDLLYKCPHHIRNHK 613 Query: 236 QICDFF 219 +I + F Sbjct: 614 KISELF 619 >XP_012079974.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Jatropha curcas] KDP31024.1 hypothetical protein JCGZ_11400 [Jatropha curcas] Length = 628 Score = 84.0 bits (206), Expect = 3e-16 Identities = 44/74 (59%), Positives = 51/74 (68%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 YISK GTVEDA FLKA S S SAYF+VF+SF KEGR SEAKDLL KCP HIR+ Sbjct: 553 YISKFGTVEDAADFLKALSVKEYPSTSAYFNVFQSFFKEGRHSEAKDLLYKCPHHIRKHP 612 Query: 236 QICDFFAFVENRMA 195 +I + F + +A Sbjct: 613 KISELFGSARSSVA 626 >XP_015067761.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Solanum pennellii] Length = 642 Score = 83.6 bits (205), Expect = 4e-16 Identities = 44/66 (66%), Positives = 47/66 (71%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 YISKSGTVEDA +FLKA S S SAY HVF+SF EGR SEAKDLL KCP HIR+ Sbjct: 556 YISKSGTVEDAVEFLKALSVKDYPSVSAYQHVFQSFFAEGRHSEAKDLLYKCPHHIRQHP 615 Query: 236 QICDFF 219 IC F Sbjct: 616 AICGLF 621 >XP_006344474.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Solanum tuberosum] Length = 642 Score = 83.6 bits (205), Expect = 4e-16 Identities = 44/66 (66%), Positives = 47/66 (71%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 YISKSGTVEDA +FLKA S S SAY HVF+SF EGR SEAKDLL KCP HIR+ Sbjct: 556 YISKSGTVEDAVEFLKALSVKDYPSVSAYQHVFQSFFAEGRHSEAKDLLYKCPHHIRQHP 615 Query: 236 QICDFF 219 IC F Sbjct: 616 AICGLF 621 >KYP70216.1 hypothetical protein KK1_009427 [Cajanus cajan] Length = 624 Score = 83.2 bits (204), Expect = 6e-16 Identities = 42/71 (59%), Positives = 50/71 (70%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 YISK G+VEDA++FLKA S S SH+ Y VFES +EGRLSEAKDLL K P HIR+ Sbjct: 546 YISKFGSVEDADQFLKALSVKSYASHTVYVQVFESLFREGRLSEAKDLLYKSPHHIRKHS 605 Query: 236 QICDFFAFVEN 204 +IC F E+ Sbjct: 606 KICKLFGSSES 616 >XP_004236267.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Solanum lycopersicum] XP_010319018.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Solanum lycopersicum] XP_010319019.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Solanum lycopersicum] Length = 642 Score = 83.2 bits (204), Expect = 6e-16 Identities = 44/66 (66%), Positives = 47/66 (71%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 YISKSGTVEDA +FLKA S S SAY HVF+SF EGR SEAKDLL KCP HIR+ Sbjct: 556 YISKSGTVEDAVEFLKALSVKDYPSVSAYQHVFQSFFAEGRHSEAKDLLYKCPYHIRQHP 615 Query: 236 QICDFF 219 IC F Sbjct: 616 AICGLF 621 >XP_019243615.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Nicotiana attenuata] XP_019243616.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Nicotiana attenuata] OIT04845.1 pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 642 Score = 82.4 bits (202), Expect = 1e-15 Identities = 43/66 (65%), Positives = 47/66 (71%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 YISKSGTVEDA +FLKA S S SAY HVF++F EGR SEAKDLL KCP HIR+ Sbjct: 556 YISKSGTVEDAVEFLKALSVKDYPSVSAYQHVFQTFFAEGRHSEAKDLLYKCPHHIRQHP 615 Query: 236 QICDFF 219 IC F Sbjct: 616 AICGLF 621 >XP_016494923.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Nicotiana tabacum] Length = 642 Score = 82.4 bits (202), Expect = 1e-15 Identities = 43/66 (65%), Positives = 47/66 (71%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 YISKSGTVEDA +FLKA S S SAY HVF++F EGR SEAKDLL KCP HIR+ Sbjct: 556 YISKSGTVEDAVEFLKALSVKDYPSVSAYQHVFQTFFAEGRHSEAKDLLYKCPHHIRQHP 615 Query: 236 QICDFF 219 IC F Sbjct: 616 AICGLF 621 >XP_009782591.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Nicotiana sylvestris] Length = 642 Score = 82.4 bits (202), Expect = 1e-15 Identities = 43/66 (65%), Positives = 47/66 (71%) Frame = -2 Query: 416 YISKSGTVEDAEKFLKAWSKGSPQSHSAYFHVFESFIKEGRLSEAKDLLCKCPSHIRRRK 237 YISKSGTVEDA +FLKA S S SAY HVF++F EGR SEAKDLL KCP HIR+ Sbjct: 556 YISKSGTVEDAVEFLKALSVKDYPSVSAYQHVFQTFFAEGRHSEAKDLLYKCPHHIRQHP 615 Query: 236 QICDFF 219 IC F Sbjct: 616 AICGLF 621