BLASTX nr result
ID: Glycyrrhiza28_contig00040211
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00040211 (357 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SEE46103.1 hypothetical protein SAMN05444164_8195 [Bradyrhizobiu... 157 1e-45 SDC53177.1 hypothetical protein SAMN05216337_1003207 [Bradyrhizo... 156 3e-45 WP_021082068.1 limonene 1,2-monooxygenase [Bradyrhizobium viridi... 156 3e-45 WP_028345230.1 fatty acid hydroxylase [Bradyrhizobium elkanii] 155 4e-45 WP_038374830.1 fatty acid hydroxylase [Bradyrhizobium elkanii] O... 154 1e-44 WP_024579638.1 MULTISPECIES: hypothetical protein [Bradyrhizobiu... 154 2e-44 WP_050387166.1 hypothetical protein [Bradyrhizobium pachyrhizi] 154 2e-44 WP_026192546.1 hypothetical protein [Bradyrhizobium elkanii] 153 3e-44 WP_028331519.1 hypothetical protein [Bradyrhizobium elkanii] 153 5e-44 WP_076833360.1 fatty acid hydroxylase [Bradyrhizobium sp. UFLA 0... 152 7e-44 WP_057020271.1 hypothetical protein [Bradyrhizobium pachyrhizi] ... 152 7e-44 WP_029082322.1 hypothetical protein [Bradyrhizobium sp. th.b2] 149 2e-42 WP_066510938.1 fatty acid hydroxylase [Bradyrhizobium sp. BR 103... 134 1e-36 WP_056295988.1 fatty acid hydroxylase [Afipia sp. Root123D2] KQW... 131 2e-35 WP_072816675.1 fatty acid hydroxylase [Bradyrhizobium erythrophl... 121 1e-31 WP_028166010.1 fatty acid hydroxylase [Bradyrhizobium elkanii] 120 2e-31 WP_020696208.1 fatty acid hydroxylase [Reyranella massiliensis] 120 2e-31 WP_027579606.1 fatty acid hydroxylase [Bradyrhizobium sp. Ai1a-2] 119 5e-31 WP_029558896.1 fatty acid hydroxylase [Xanthobacter sp. 91] 119 5e-31 WP_024278524.1 fatty acid hydroxylase [Xanthobacter sp. 126] 119 5e-31 >SEE46103.1 hypothetical protein SAMN05444164_8195 [Bradyrhizobium erythrophlei] Length = 265 Score = 157 bits (397), Expect = 1e-45 Identities = 74/75 (98%), Positives = 75/75 (100%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGH+FNGYSTRYVKTDMRRTART Sbjct: 191 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHIFNGYSTRYVKTDMRRTART 250 Query: 183 PRVVVKEQSVPHAAA 227 PRVVVKEQSVPHAAA Sbjct: 251 PRVVVKEQSVPHAAA 265 >SDC53177.1 hypothetical protein SAMN05216337_1003207 [Bradyrhizobium sp. R5] Length = 265 Score = 156 bits (394), Expect = 3e-45 Identities = 74/75 (98%), Positives = 74/75 (98%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART Sbjct: 191 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 250 Query: 183 PRVVVKEQSVPHAAA 227 PRVV KEQSVPHAAA Sbjct: 251 PRVVAKEQSVPHAAA 265 >WP_021082068.1 limonene 1,2-monooxygenase [Bradyrhizobium viridifuturi] ERF84829.1 limonene 1,2-monooxygenase [Bradyrhizobium sp. DFCI-1] Length = 265 Score = 156 bits (394), Expect = 3e-45 Identities = 74/75 (98%), Positives = 75/75 (100%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART Sbjct: 191 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 250 Query: 183 PRVVVKEQSVPHAAA 227 PRVVVKE+SVPHAAA Sbjct: 251 PRVVVKERSVPHAAA 265 >WP_028345230.1 fatty acid hydroxylase [Bradyrhizobium elkanii] Length = 265 Score = 155 bits (393), Expect = 4e-45 Identities = 73/75 (97%), Positives = 74/75 (98%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGH+FNGYSTRYVKTDMRRTART Sbjct: 191 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHIFNGYSTRYVKTDMRRTART 250 Query: 183 PRVVVKEQSVPHAAA 227 PRVV KEQSVPHAAA Sbjct: 251 PRVVAKEQSVPHAAA 265 >WP_038374830.1 fatty acid hydroxylase [Bradyrhizobium elkanii] ODM72306.1 fatty acid hydroxylase [Bradyrhizobium elkanii] ODM73755.1 fatty acid hydroxylase [Bradyrhizobium elkanii] OIM92753.1 fatty acid hydroxylase [Bradyrhizobium elkanii] Length = 265 Score = 154 bits (390), Expect = 1e-44 Identities = 72/75 (96%), Positives = 74/75 (98%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGH+FNGYSTRYVKTDMRRTART Sbjct: 191 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHIFNGYSTRYVKTDMRRTART 250 Query: 183 PRVVVKEQSVPHAAA 227 PRVV K+QSVPHAAA Sbjct: 251 PRVVAKQQSVPHAAA 265 >WP_024579638.1 MULTISPECIES: hypothetical protein [Bradyrhizobium] OCX30630.1 fatty acid hydroxylase [Bradyrhizobium sp. UASWS1016] Length = 265 Score = 154 bits (389), Expect = 2e-44 Identities = 73/75 (97%), Positives = 73/75 (97%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHHNQSIMMERNMNLTFPVMDY FGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART Sbjct: 191 RHHTAHHNQSIMMERNMNLTFPVMDYAFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 250 Query: 183 PRVVVKEQSVPHAAA 227 PRVVVKEQ VPHAAA Sbjct: 251 PRVVVKEQPVPHAAA 265 >WP_050387166.1 hypothetical protein [Bradyrhizobium pachyrhizi] Length = 265 Score = 154 bits (388), Expect = 2e-44 Identities = 72/75 (96%), Positives = 74/75 (98%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGH+FNGYSTR+VKTDMRRTART Sbjct: 191 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHIFNGYSTRHVKTDMRRTART 250 Query: 183 PRVVVKEQSVPHAAA 227 PRVV KEQSVPHAAA Sbjct: 251 PRVVAKEQSVPHAAA 265 >WP_026192546.1 hypothetical protein [Bradyrhizobium elkanii] Length = 265 Score = 153 bits (387), Expect = 3e-44 Identities = 71/75 (94%), Positives = 74/75 (98%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGH+FNGYSTRYVKTDMRRTART Sbjct: 191 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHIFNGYSTRYVKTDMRRTART 250 Query: 183 PRVVVKEQSVPHAAA 227 PRVV K+QS+PHAAA Sbjct: 251 PRVVAKQQSMPHAAA 265 >WP_028331519.1 hypothetical protein [Bradyrhizobium elkanii] Length = 265 Score = 153 bits (386), Expect = 5e-44 Identities = 72/75 (96%), Positives = 73/75 (97%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGH+FNGYSTRYVKTDMRRTART Sbjct: 191 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHIFNGYSTRYVKTDMRRTART 250 Query: 183 PRVVVKEQSVPHAAA 227 PRVV K QSVPHAAA Sbjct: 251 PRVVAKGQSVPHAAA 265 >WP_076833360.1 fatty acid hydroxylase [Bradyrhizobium sp. UFLA 03-321] OMI01244.1 fatty acid hydroxylase [Bradyrhizobium sp. UFLA 03-321] Length = 265 Score = 152 bits (385), Expect = 7e-44 Identities = 71/75 (94%), Positives = 74/75 (98%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGH+FNGYSTR+VKTDMRRTART Sbjct: 191 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHIFNGYSTRHVKTDMRRTART 250 Query: 183 PRVVVKEQSVPHAAA 227 PRV+ KEQSVPHAAA Sbjct: 251 PRVMAKEQSVPHAAA 265 >WP_057020271.1 hypothetical protein [Bradyrhizobium pachyrhizi] KRP87065.1 fatty acid hydroxylase [Bradyrhizobium pachyrhizi] Length = 265 Score = 152 bits (385), Expect = 7e-44 Identities = 71/75 (94%), Positives = 74/75 (98%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGH+FNGYSTR+VKTDMRRTART Sbjct: 191 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHIFNGYSTRHVKTDMRRTART 250 Query: 183 PRVVVKEQSVPHAAA 227 PRV+ KEQSVPHAAA Sbjct: 251 PRVMAKEQSVPHAAA 265 >WP_029082322.1 hypothetical protein [Bradyrhizobium sp. th.b2] Length = 265 Score = 149 bits (375), Expect = 2e-42 Identities = 70/75 (93%), Positives = 72/75 (96%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHHNQSIMMERNMNLTFPVMD + GTSDLNRGLLGH+FNGYSTRYVKTDMRRTART Sbjct: 191 RHHTAHHNQSIMMERNMNLTFPVMDCLLGTSDLNRGLLGHIFNGYSTRYVKTDMRRTART 250 Query: 183 PRVVVKEQSVPHAAA 227 PRV VKEQSVPHAAA Sbjct: 251 PRVAVKEQSVPHAAA 265 >WP_066510938.1 fatty acid hydroxylase [Bradyrhizobium sp. BR 10303] KWV51469.1 fatty acid hydroxylase [Bradyrhizobium sp. BR 10303] Length = 261 Score = 134 bits (336), Expect = 1e-36 Identities = 61/63 (96%), Positives = 63/63 (100%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHHNQSIMMERNMNLTFPVMDY+FGTSDLNRGLLGH+FNGYSTRYVKTDMRRTART Sbjct: 191 RHHTAHHNQSIMMERNMNLTFPVMDYLFGTSDLNRGLLGHIFNGYSTRYVKTDMRRTART 250 Query: 183 PRV 191 PRV Sbjct: 251 PRV 253 >WP_056295988.1 fatty acid hydroxylase [Afipia sp. Root123D2] KQW20471.1 fatty acid hydroxylase [Afipia sp. Root123D2] Length = 261 Score = 131 bits (329), Expect = 2e-35 Identities = 63/71 (88%), Positives = 66/71 (92%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHH+QSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTR+VKTDMRRT+RT Sbjct: 191 RHHTAHHDQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRFVKTDMRRTSRT 250 Query: 183 PRVVVKEQSVP 215 PRV SVP Sbjct: 251 PRVT--PSSVP 259 >WP_072816675.1 fatty acid hydroxylase [Bradyrhizobium erythrophlei] SHN65053.1 Fatty acid hydroxylase superfamily protein [Bradyrhizobium erythrophlei] Length = 263 Score = 121 bits (303), Expect = 1e-31 Identities = 54/70 (77%), Positives = 63/70 (90%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHH AHH+QSIMMERNMNLTFP+MD++FGTSDLNRGLLGHVFNGY TR+VK DMR+T+RT Sbjct: 191 RHHAAHHDQSIMMERNMNLTFPIMDWLFGTSDLNRGLLGHVFNGYDTRFVKRDMRKTSRT 250 Query: 183 PRVVVKEQSV 212 P++ V SV Sbjct: 251 PKIDVSIHSV 260 >WP_028166010.1 fatty acid hydroxylase [Bradyrhizobium elkanii] Length = 263 Score = 120 bits (302), Expect = 2e-31 Identities = 54/71 (76%), Positives = 64/71 (90%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHH+QSIMMERNMNLTFP+MD++FGTSDL+RGLLGH+FNGY TR+VK +MR+TART Sbjct: 191 RHHTAHHDQSIMMERNMNLTFPIMDWLFGTSDLDRGLLGHLFNGYETRFVKRNMRKTART 250 Query: 183 PRVVVKEQSVP 215 PR+ SVP Sbjct: 251 PRIDPAVSSVP 261 >WP_020696208.1 fatty acid hydroxylase [Reyranella massiliensis] Length = 266 Score = 120 bits (302), Expect = 2e-31 Identities = 53/62 (85%), Positives = 61/62 (98%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHH+QSIMMERNMNLTFPVMD++FGTSDL+RGLLGH+FNGYSTRY++ DMRRT+RT Sbjct: 191 RHHTAHHDQSIMMERNMNLTFPVMDWLFGTSDLDRGLLGHLFNGYSTRYIRKDMRRTSRT 250 Query: 183 PR 188 PR Sbjct: 251 PR 252 >WP_027579606.1 fatty acid hydroxylase [Bradyrhizobium sp. Ai1a-2] Length = 263 Score = 119 bits (299), Expect = 5e-31 Identities = 53/71 (74%), Positives = 64/71 (90%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHHTAHH+QSIMMERNMNLTFP+MD++FGTSDL+RGLLGH+FNGY TR+VK +MR+T+RT Sbjct: 191 RHHTAHHDQSIMMERNMNLTFPIMDWLFGTSDLDRGLLGHLFNGYETRFVKRNMRKTSRT 250 Query: 183 PRVVVKEQSVP 215 PR+ SVP Sbjct: 251 PRIDPAVSSVP 261 >WP_029558896.1 fatty acid hydroxylase [Xanthobacter sp. 91] Length = 265 Score = 119 bits (299), Expect = 5e-31 Identities = 51/62 (82%), Positives = 59/62 (95%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHH AHHNQS+MMERNMNLTFP+MD+ FGTSDLNRGL+GH+FNGY TR++KTDMRRTART Sbjct: 191 RHHAAHHNQSLMMERNMNLTFPIMDWAFGTSDLNRGLIGHLFNGYDTRHLKTDMRRTART 250 Query: 183 PR 188 P+ Sbjct: 251 PK 252 >WP_024278524.1 fatty acid hydroxylase [Xanthobacter sp. 126] Length = 265 Score = 119 bits (299), Expect = 5e-31 Identities = 51/62 (82%), Positives = 59/62 (95%) Frame = +3 Query: 3 RHHTAHHNQSIMMERNMNLTFPVMDYVFGTSDLNRGLLGHVFNGYSTRYVKTDMRRTART 182 RHH AHHNQS+MMERNMNLTFP+MD+ FGTSDLNRGL+GH+FNGY TR++KTDMRRTART Sbjct: 191 RHHAAHHNQSLMMERNMNLTFPIMDWAFGTSDLNRGLIGHLFNGYDTRHLKTDMRRTART 250 Query: 183 PR 188 P+ Sbjct: 251 PK 252