BLASTX nr result
ID: Glycyrrhiza28_contig00040080
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00040080 (255 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU21817.1 hypothetical protein TSUD_176640 [Trifolium subterran... 79 2e-15 XP_003622988.2 general transcription factor 3C-like protein [Med... 54 2e-06 >GAU21817.1 hypothetical protein TSUD_176640 [Trifolium subterraneum] Length = 356 Score = 79.0 bits (193), Expect = 2e-15 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = +3 Query: 126 FLSP*K*KYLETYCNKIALLWFWFYLAVLQIPKKVNWEEYIPE 254 F+S K KYLETYCNK ALLWFWFYLAVLQIPKKVNWEEYIP+ Sbjct: 4 FISLYKVKYLETYCNK-ALLWFWFYLAVLQIPKKVNWEEYIPQ 45 >XP_003622988.2 general transcription factor 3C-like protein [Medicago truncatula] AES79206.2 general transcription factor 3C-like protein [Medicago truncatula] Length = 584 Score = 53.9 bits (128), Expect = 2e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +3 Query: 156 ETYCNKIALLWFWFYLAVLQIPKKVNWEEYIPE 254 E IALLWF F LAVLQIPKKVNWEEYIP+ Sbjct: 246 ENISKHIALLWFSFDLAVLQIPKKVNWEEYIPQ 278