BLASTX nr result
ID: Glycyrrhiza28_contig00039977
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00039977 (363 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004493948.1 PREDICTED: interactor of constitutive active ROPs... 113 6e-27 XP_003625583.1 interactor of constitutive active ROPs-like prote... 104 9e-24 XP_003520644.1 PREDICTED: interactor of constitutive active ROPs... 103 2e-23 KYP70845.1 hypothetical protein KK1_010083 [Cajanus cajan] 102 6e-23 XP_006604555.1 PREDICTED: interactor of constitutive active ROPs... 100 5e-22 XP_019428537.1 PREDICTED: interactor of constitutive active ROPs... 99 1e-21 XP_006577009.1 PREDICTED: interactor of constitutive active ROPs... 97 3e-21 XP_015578502.1 PREDICTED: interactor of constitutive active ROPs... 97 3e-21 XP_010244974.1 PREDICTED: interactor of constitutive active ROPs... 97 4e-21 KHN39107.1 Interactor of constitutive active ROPs 2, chloroplast... 97 4e-21 XP_006588759.1 PREDICTED: interactor of constitutive active ROPs... 97 4e-21 XP_015969987.1 PREDICTED: interactor of constitutive active ROPs... 96 1e-20 KJB33007.1 hypothetical protein B456_006G1686001 [Gossypium raim... 96 2e-20 XP_017607944.1 PREDICTED: interactor of constitutive active ROPs... 94 4e-20 XP_016669615.1 PREDICTED: interactor of constitutive active ROPs... 94 4e-20 EOY07755.1 ROP interactive partner 3 isoform 1 [Theobroma cacao] 94 5e-20 XP_003542499.1 PREDICTED: interactor of constitutive active ROPs... 94 7e-20 KHN48324.1 Interactor of constitutive active ROPs 2, chloroplast... 94 7e-20 XP_016207969.1 PREDICTED: interactor of constitutive active ROPs... 93 1e-19 XP_007027253.2 PREDICTED: interactor of constitutive active ROPs... 93 1e-19 >XP_004493948.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Cicer arietinum] XP_004493949.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Cicer arietinum] XP_004493950.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Cicer arietinum] XP_012569437.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Cicer arietinum] XP_012569438.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Cicer arietinum] Length = 618 Score = 113 bits (283), Expect = 6e-27 Identities = 62/84 (73%), Positives = 66/84 (78%), Gaps = 1/84 (1%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTA-RKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIER 290 MQTPKARASASE+PQRKSPVTPR A R+LKT +RK PKDRSPKVIER Sbjct: 1 MQTPKARASASELPQRKSPVTPRAAARQLKTPNSGSNSASSSPNPLRKLPKDRSPKVIER 60 Query: 291 RLSQSPIAEKKRPSKVQELESQIA 362 RLS SPI+EKKRPSKVQELESQIA Sbjct: 61 RLSHSPISEKKRPSKVQELESQIA 84 >XP_003625583.1 interactor of constitutive active ROPs-like protein [Medicago truncatula] AES81801.1 interactor of constitutive active ROPs-like protein [Medicago truncatula] Length = 610 Score = 104 bits (260), Expect = 9e-24 Identities = 58/84 (69%), Positives = 63/84 (75%), Gaps = 1/84 (1%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPV-TPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIER 290 MQTPKAR+SA E+ QRKSP TPRTAR+LKT IRKTPKD SP+V ER Sbjct: 1 MQTPKARSSAPEMSQRKSPAATPRTARQLKTPNSGSNSASSSPNPIRKTPKDMSPRVNER 60 Query: 291 RLSQSPIAEKKRPSKVQELESQIA 362 RLS SPI+EKKRPSKVQELESQIA Sbjct: 61 RLSHSPISEKKRPSKVQELESQIA 84 >XP_003520644.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] KHN09475.1 Interactor of constitutive active ROPs 2, chloroplastic [Glycine soja] KRH67645.1 hypothetical protein GLYMA_03G178100 [Glycine max] Length = 621 Score = 103 bits (258), Expect = 2e-23 Identities = 57/83 (68%), Positives = 61/83 (73%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTPKAR ASEVPQ+KSP TPRTAR+LKT +KTPKDRSPKVIE R Sbjct: 1 MQTPKARVGASEVPQKKSPATPRTARQLKTPNSDAYSVSSPNAA-KKTPKDRSPKVIECR 59 Query: 294 LSQSPIAEKKRPSKVQELESQIA 362 SPI+EKKRPSKVQELESQIA Sbjct: 60 SPHSPISEKKRPSKVQELESQIA 82 >KYP70845.1 hypothetical protein KK1_010083 [Cajanus cajan] Length = 605 Score = 102 bits (254), Expect = 6e-23 Identities = 53/82 (64%), Positives = 62/82 (75%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTPKARA SEVPQ+KSPVTPRTAR+LK +KTPK+RSPKV+ERR Sbjct: 1 MQTPKARAGTSEVPQKKSPVTPRTARQLKIPNSDSDLVSSPNAA-KKTPKNRSPKVVERR 59 Query: 294 LSQSPIAEKKRPSKVQELESQI 359 QSP++EKKRPS++QELESQI Sbjct: 60 SPQSPVSEKKRPSRIQELESQI 81 >XP_006604555.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] XP_006604561.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] XP_014627485.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] XP_014627486.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] XP_014627487.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] XP_014627488.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] XP_014627489.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] XP_014627490.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] KRG95931.1 hypothetical protein GLYMA_19G178900 [Glycine max] KRG95932.1 hypothetical protein GLYMA_19G178900 [Glycine max] KRG95933.1 hypothetical protein GLYMA_19G178900 [Glycine max] KRG95934.1 hypothetical protein GLYMA_19G178900 [Glycine max] KRG95935.1 hypothetical protein GLYMA_19G178900 [Glycine max] KRG95936.1 hypothetical protein GLYMA_19G178900 [Glycine max] KRG95937.1 hypothetical protein GLYMA_19G178900 [Glycine max] KRG95938.1 hypothetical protein GLYMA_19G178900 [Glycine max] KRG95939.1 hypothetical protein GLYMA_19G178900 [Glycine max] Length = 623 Score = 99.8 bits (247), Expect = 5e-22 Identities = 54/83 (65%), Positives = 59/83 (71%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTPKAR SEVPQ+KSP TPRTA +LKT +KT KDRSPK+IERR Sbjct: 1 MQTPKARVGMSEVPQKKSPATPRTAHQLKTPNSDADSVSSPNAA-KKTSKDRSPKIIERR 59 Query: 294 LSQSPIAEKKRPSKVQELESQIA 362 SPI+EKKRPSKVQELESQIA Sbjct: 60 SPHSPISEKKRPSKVQELESQIA 82 >XP_019428537.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Lupinus angustifolius] XP_019428538.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Lupinus angustifolius] OIV90488.1 hypothetical protein TanjilG_18672 [Lupinus angustifolius] Length = 625 Score = 98.6 bits (244), Expect = 1e-21 Identities = 51/83 (61%), Positives = 58/83 (69%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTP+AR+ SEVPQRKSP TPRTAR LKT TPK+RSPKV ER+ Sbjct: 1 MQTPRARSGTSEVPQRKSPATPRTARHLKTPGSDTYSVSSSPNPASTTPKNRSPKVTERK 60 Query: 294 LSQSPIAEKKRPSKVQELESQIA 362 +SPI EKKRPS+VQELESQ+A Sbjct: 61 SPRSPIPEKKRPSRVQELESQLA 83 >XP_006577009.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Glycine max] KRH67644.1 hypothetical protein GLYMA_03G178100 [Glycine max] Length = 620 Score = 97.4 bits (241), Expect = 3e-21 Identities = 56/83 (67%), Positives = 60/83 (72%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTPKAR ASEVPQ+KSP TPRTAR+LKT +KTPKDRSPKVIE R Sbjct: 1 MQTPKARVGASEVPQKKSPATPRTARQLKT-PNSDAYSVSSPNAAKKTPKDRSPKVIECR 59 Query: 294 LSQSPIAEKKRPSKVQELESQIA 362 SPI+E KRPSKVQELESQIA Sbjct: 60 SPHSPISE-KRPSKVQELESQIA 81 >XP_015578502.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic isoform X3 [Ricinus communis] Length = 622 Score = 97.4 bits (241), Expect = 3e-21 Identities = 53/83 (63%), Positives = 59/83 (71%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTPKAR S+SEVPQRKSP TPRTAR+LKT R TPKD+SPKV ERR Sbjct: 1 MQTPKARTSSSEVPQRKSPATPRTARQLKTPGSDSDSVSSPNPANR-TPKDKSPKVTERR 59 Query: 294 LSQSPIAEKKRPSKVQELESQIA 362 +SP EKKRPS+V ELESQ+A Sbjct: 60 SPRSPAIEKKRPSRVSELESQLA 82 >XP_010244974.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Nelumbo nucifera] XP_010244975.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Nelumbo nucifera] XP_010244976.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Nelumbo nucifera] XP_010244977.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Nelumbo nucifera] XP_019051729.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Nelumbo nucifera] Length = 618 Score = 97.1 bits (240), Expect = 4e-21 Identities = 51/83 (61%), Positives = 60/83 (72%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTPKAR+ +SEVPQR SP TPR AR+LKT + +TPKDRSPKV+ERR Sbjct: 1 MQTPKARSGSSEVPQRTSPGTPRAARQLKTTGSESDSVSSTTP-VSRTPKDRSPKVVERR 59 Query: 294 LSQSPIAEKKRPSKVQELESQIA 362 +SPI EKKRPS+V ELESQ+A Sbjct: 60 SPRSPITEKKRPSRVSELESQLA 82 >KHN39107.1 Interactor of constitutive active ROPs 2, chloroplastic [Glycine soja] Length = 626 Score = 97.1 bits (240), Expect = 4e-21 Identities = 50/83 (60%), Positives = 58/83 (69%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTPKAR SEVPQRKSP +P+ ARKLKT KTPK+RSPKV ER+ Sbjct: 1 MQTPKARTGTSEVPQRKSPASPQNARKLKTPGSDTDSVSSSPKPGSKTPKNRSPKVTERK 60 Query: 294 LSQSPIAEKKRPSKVQELESQIA 362 +SPI+EKKRP +VQELESQ+A Sbjct: 61 SPRSPISEKKRPGRVQELESQLA 83 >XP_006588759.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_006588760.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_006588761.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_006588762.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_006588763.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_014618467.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_014618468.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_014618469.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_014618470.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] KRH32410.1 hypothetical protein GLYMA_10G049600 [Glycine max] KRH32411.1 hypothetical protein GLYMA_10G049600 [Glycine max] KRH32412.1 hypothetical protein GLYMA_10G049600 [Glycine max] KRH32413.1 hypothetical protein GLYMA_10G049600 [Glycine max] Length = 626 Score = 97.1 bits (240), Expect = 4e-21 Identities = 50/83 (60%), Positives = 58/83 (69%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTPKAR SEVPQRKSP +P+ ARKLKT KTPK+RSPKV ER+ Sbjct: 1 MQTPKARTGTSEVPQRKSPASPQNARKLKTPGSDTDSVSSSPKPGSKTPKNRSPKVTERK 60 Query: 294 LSQSPIAEKKRPSKVQELESQIA 362 +SPI+EKKRP +VQELESQ+A Sbjct: 61 SPRSPISEKKRPGRVQELESQLA 83 >XP_015969987.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Arachis duranensis] XP_015969988.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Arachis duranensis] XP_015969989.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Arachis duranensis] Length = 623 Score = 95.9 bits (237), Expect = 1e-20 Identities = 54/84 (64%), Positives = 59/84 (70%), Gaps = 1/84 (1%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPV-TPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIER 290 M TPKAR ++SE+PQRKSPV TPRTAR LKT RK+ KDRSPKVIE Sbjct: 1 MHTPKARTNSSEMPQRKSPVNTPRTARMLKTPNSDSDSLSSSPNPARKSLKDRSPKVIEH 60 Query: 291 RLSQSPIAEKKRPSKVQELESQIA 362 R QSPI EKKR SKVQELESQI+ Sbjct: 61 RSPQSPITEKKRSSKVQELESQIS 84 >KJB33007.1 hypothetical protein B456_006G1686001 [Gossypium raimondii] KJB33011.1 hypothetical protein B456_006G1686001 [Gossypium raimondii] Length = 619 Score = 95.5 bits (236), Expect = 2e-20 Identities = 50/82 (60%), Positives = 59/82 (71%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTPK R S++EVPQRKSP TPRTAR+LK KTPKDRSPKV ER+ Sbjct: 1 MQTPKGRTSSAEVPQRKSPATPRTARQLKIPGSDSEAVSSPNPA-SKTPKDRSPKVTERK 59 Query: 294 LSQSPIAEKKRPSKVQELESQI 359 + +SP+AEKKRPS+V ELESQ+ Sbjct: 60 VLRSPVAEKKRPSRVTELESQL 81 >XP_017607944.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic isoform X4 [Gossypium arboreum] Length = 619 Score = 94.4 bits (233), Expect = 4e-20 Identities = 50/82 (60%), Positives = 58/82 (70%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTPK R S+ EVPQRKSP TPRTAR+LK KTPKDRSPKV ER+ Sbjct: 1 MQTPKGRTSSVEVPQRKSPATPRTARQLKIPGSDSEAVSSPNPA-SKTPKDRSPKVTERK 59 Query: 294 LSQSPIAEKKRPSKVQELESQI 359 + +SP+AEKKRPS+V ELESQ+ Sbjct: 60 VLRSPVAEKKRPSRVTELESQL 81 >XP_016669615.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X2 [Gossypium hirsutum] Length = 619 Score = 94.4 bits (233), Expect = 4e-20 Identities = 50/82 (60%), Positives = 58/82 (70%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTPK R S+ EVPQRKSP TPRTAR+LK KTPKDRSPKV ER+ Sbjct: 1 MQTPKGRTSSVEVPQRKSPATPRTARQLKIPGSDSEAVSSPNPA-SKTPKDRSPKVTERK 59 Query: 294 LSQSPIAEKKRPSKVQELESQI 359 + +SP+AEKKRPS+V ELESQ+ Sbjct: 60 VLRSPVAEKKRPSRVTELESQL 81 >EOY07755.1 ROP interactive partner 3 isoform 1 [Theobroma cacao] Length = 619 Score = 94.0 bits (232), Expect = 5e-20 Identities = 50/82 (60%), Positives = 58/82 (70%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTPKAR S+ EVPQRKSP TPRTAR+LKT KTPKDRSPKV R+ Sbjct: 1 MQTPKARTSSLEVPQRKSPATPRTARQLKTPGPDSDTVSSPNPA-SKTPKDRSPKVTARK 59 Query: 294 LSQSPIAEKKRPSKVQELESQI 359 +SP++EK+RPSKV ELESQ+ Sbjct: 60 ALRSPVSEKQRPSKVSELESQL 81 >XP_003542499.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_006594115.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_006594116.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] XP_006594117.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like isoform X1 [Glycine max] KRH19817.1 hypothetical protein GLYMA_13G137200 [Glycine max] KRH19818.1 hypothetical protein GLYMA_13G137200 [Glycine max] KRH19819.1 hypothetical protein GLYMA_13G137200 [Glycine max] KRH19820.1 hypothetical protein GLYMA_13G137200 [Glycine max] Length = 624 Score = 93.6 bits (231), Expect = 7e-20 Identities = 48/83 (57%), Positives = 58/83 (69%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTPKAR SEVPQRKSP +P+ ARKLKT KTPK++SPKV ER+ Sbjct: 1 MQTPKARTGTSEVPQRKSPASPQNARKLKTPGSDTDSVSSSPKPGSKTPKNKSPKVTERK 60 Query: 294 LSQSPIAEKKRPSKVQELESQIA 362 +SPI+EKK+PS+VQE ESQ+A Sbjct: 61 SPRSPISEKKQPSRVQESESQLA 83 >KHN48324.1 Interactor of constitutive active ROPs 2, chloroplastic [Glycine soja] Length = 625 Score = 93.6 bits (231), Expect = 7e-20 Identities = 48/83 (57%), Positives = 58/83 (69%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTPKAR SEVPQRKSP +P+ ARKLKT KTPK++SPKV ER+ Sbjct: 1 MQTPKARTGTSEVPQRKSPASPQNARKLKTPGSDTDSVSSSPKPGSKTPKNKSPKVTERK 60 Query: 294 LSQSPIAEKKRPSKVQELESQIA 362 +SPI+EKK+PS+VQE ESQ+A Sbjct: 61 SPRSPISEKKQPSRVQESESQLA 83 >XP_016207969.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Arachis ipaensis] XP_016207970.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Arachis ipaensis] XP_016207971.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Arachis ipaensis] XP_016207972.1 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Arachis ipaensis] Length = 623 Score = 93.2 bits (230), Expect = 1e-19 Identities = 53/84 (63%), Positives = 58/84 (69%), Gaps = 1/84 (1%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPV-TPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIER 290 M TPKAR ++SE+PQRKSPV TPRTAR LKT RK+ KDRSPKV E Sbjct: 1 MHTPKARTNSSEMPQRKSPVNTPRTARMLKTPNSDSDSLSSSPNPARKSLKDRSPKVNEH 60 Query: 291 RLSQSPIAEKKRPSKVQELESQIA 362 R QSPI EKKR SKVQELESQI+ Sbjct: 61 RSPQSPITEKKRSSKVQELESQIS 84 >XP_007027253.2 PREDICTED: interactor of constitutive active ROPs 2, chloroplastic [Theobroma cacao] Length = 619 Score = 92.8 bits (229), Expect = 1e-19 Identities = 49/82 (59%), Positives = 58/82 (70%) Frame = +3 Query: 114 MQTPKARASASEVPQRKSPVTPRTARKLKTXXXXXXXXXXXXXXIRKTPKDRSPKVIERR 293 MQTPKAR S+ EVPQRKSP TPRTAR+LKT KTPKDRSPKV R+ Sbjct: 1 MQTPKARTSSLEVPQRKSPATPRTARQLKTPGPDSDTVSSPNPA-SKTPKDRSPKVTARK 59 Query: 294 LSQSPIAEKKRPSKVQELESQI 359 +SP++EK+RP+KV ELESQ+ Sbjct: 60 ALRSPVSEKQRPNKVSELESQL 81