BLASTX nr result
ID: Glycyrrhiza28_contig00039931
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00039931 (295 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU48491.1 hypothetical protein TSUD_291760 [Trifolium subterran... 58 3e-11 >GAU48491.1 hypothetical protein TSUD_291760 [Trifolium subterraneum] Length = 152 Score = 58.2 bits (139), Expect(2) = 3e-11 Identities = 33/55 (60%), Positives = 34/55 (61%) Frame = -2 Query: 294 DRLRETISIHTGEVLSRARLYWAEVIXXXXXXXXXXXXXXXXXXXXXLEDLTLMV 130 DRLRETISIHTGEVLSRARLYWAEVI LEDLTLM+ Sbjct: 16 DRLRETISIHTGEVLSRARLYWAEVILSLLEELERKRHQFRCLLPLHLEDLTLML 70 Score = 37.4 bits (85), Expect(2) = 3e-11 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 50 PFFASNERKEGREGCA 3 PFFASN+RKEGREGCA Sbjct: 72 PFFASNDRKEGREGCA 87