BLASTX nr result
ID: Glycyrrhiza28_contig00039822
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00039822 (355 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SEC26938.1 hypothetical protein SAMN05444164_1429 [Bradyrhizobiu... 56 2e-08 >SEC26938.1 hypothetical protein SAMN05444164_1429 [Bradyrhizobium erythrophlei] Length = 42 Score = 55.8 bits (133), Expect = 2e-08 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -2 Query: 159 MAELIINVFVEVIADIWTLQCLARWRKKK-ATHETAPDQRSD 37 MAE IIN+ +VI DIWTLQCLARWR+K+ TA +QRS+ Sbjct: 1 MAEFIINLIADVITDIWTLQCLARWRRKREGPRRTASEQRSN 42