BLASTX nr result
ID: Glycyrrhiza28_contig00039766
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00039766 (322 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_050630734.1 branched-chain amino acid ABC transporter substra... 83 2e-16 WP_076863988.1 branched-chain amino acid ABC transporter substra... 83 2e-16 WP_074130712.1 branched-chain amino acid ABC transporter substra... 83 2e-16 SDD51754.1 amino acid/amide ABC transporter substrate-binding pr... 83 2e-16 WP_024581948.1 MULTISPECIES: branched-chain amino acid ABC trans... 83 2e-16 WP_076824712.1 branched-chain amino acid ABC transporter substra... 83 2e-16 WP_057015563.1 branched-chain amino acid ABC transporter substra... 83 2e-16 WP_050387755.1 branched-chain amino acid ABC transporter substra... 83 2e-16 WP_038387061.1 branched-chain amino acid ABC transporter substra... 83 2e-16 WP_028343586.1 branched-chain amino acid ABC transporter substra... 83 2e-16 WP_016843309.1 branched-chain amino acid ABC transporter substra... 83 2e-16 WP_075969115.1 branched-chain amino acid ABC transporter substra... 83 2e-16 WP_069279780.1 branched-chain amino acid ABC transporter substra... 82 6e-16 WP_028337330.1 branched-chain amino acid ABC transporter substra... 81 1e-15 WP_066508942.1 branched-chain amino acid ABC transporter substra... 77 2e-14 WP_027533413.1 branched-chain amino acid ABC transporter substra... 76 5e-14 WP_074116945.1 branched-chain amino acid ABC transporter substra... 76 5e-14 WP_063678627.1 branched-chain amino acid ABC transporter substra... 76 5e-14 WP_027553400.1 branched-chain amino acid ABC transporter substra... 76 5e-14 WP_027515131.1 branched-chain amino acid ABC transporter substra... 75 2e-13 >WP_050630734.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium viridifuturi] Length = 440 Score = 83.2 bits (204), Expect = 2e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 EKEMKNKEDYYEVVEI+PGDGLMQKPDAFGCHLGDYT Sbjct: 404 EKEMKNKEDYYEVVEIVPGDGLMQKPDAFGCHLGDYT 440 >WP_076863988.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium sp. SEMIA 6399] Length = 451 Score = 83.2 bits (204), Expect = 2e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 EKEMKNKEDYYEVVEI+PGDGLMQKPDAFGCHLGDYT Sbjct: 415 EKEMKNKEDYYEVVEIVPGDGLMQKPDAFGCHLGDYT 451 >WP_074130712.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium sp. NAS96.2] OKO70249.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium sp. NAS96.2] Length = 451 Score = 83.2 bits (204), Expect = 2e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 EKEMKNKEDYYEVVEI+PGDGLMQKPDAFGCHLGDYT Sbjct: 415 EKEMKNKEDYYEVVEIVPGDGLMQKPDAFGCHLGDYT 451 >SDD51754.1 amino acid/amide ABC transporter substrate-binding protein, HAAT family [Bradyrhizobium sp. R5] Length = 451 Score = 83.2 bits (204), Expect = 2e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 EKEMKNKEDYYEVVEI+PGDGLMQKPDAFGCHLGDYT Sbjct: 415 EKEMKNKEDYYEVVEIVPGDGLMQKPDAFGCHLGDYT 451 >WP_024581948.1 MULTISPECIES: branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium] KIU49805.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium elkanii] OCX32115.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium sp. UASWS1016] Length = 451 Score = 83.2 bits (204), Expect = 2e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 EKEMKNKEDYYEVVEI+PGDGLMQKPDAFGCHLGDYT Sbjct: 415 EKEMKNKEDYYEVVEIVPGDGLMQKPDAFGCHLGDYT 451 >WP_076824712.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium sp. UFLA 03-321] OMI14947.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium sp. UFLA 03-321] Length = 451 Score = 82.8 bits (203), Expect = 2e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 EKEMKNKEDYYEV+EI+PGDGLMQKPDAFGCHLGDYT Sbjct: 415 EKEMKNKEDYYEVIEIVPGDGLMQKPDAFGCHLGDYT 451 >WP_057015563.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium pachyrhizi] KRQ12232.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium pachyrhizi] Length = 451 Score = 82.8 bits (203), Expect = 2e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 EKEMKNKEDYYEV+EI+PGDGLMQKPDAFGCHLGDYT Sbjct: 415 EKEMKNKEDYYEVIEIVPGDGLMQKPDAFGCHLGDYT 451 >WP_050387755.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium pachyrhizi] Length = 451 Score = 82.8 bits (203), Expect = 2e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 EKEMKNKEDYYEV+EI+PGDGLMQKPDAFGCHLGDYT Sbjct: 415 EKEMKNKEDYYEVIEIVPGDGLMQKPDAFGCHLGDYT 451 >WP_038387061.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium elkanii] Length = 451 Score = 82.8 bits (203), Expect = 2e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 EKEMKNKEDYYEV+EI+PGDGLMQKPDAFGCHLGDYT Sbjct: 415 EKEMKNKEDYYEVIEIVPGDGLMQKPDAFGCHLGDYT 451 >WP_028343586.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium elkanii] Length = 451 Score = 82.8 bits (203), Expect = 2e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 EKEMKNKEDYYEV+EI+PGDGLMQKPDAFGCHLGDYT Sbjct: 415 EKEMKNKEDYYEVIEIVPGDGLMQKPDAFGCHLGDYT 451 >WP_016843309.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium elkanii] Length = 451 Score = 82.8 bits (203), Expect = 2e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 EKEMKNKEDYYEV+EI+PGDGLMQKPDAFGCHLGDYT Sbjct: 415 EKEMKNKEDYYEVIEIVPGDGLMQKPDAFGCHLGDYT 451 >WP_075969115.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium elkanii] OIM90095.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium elkanii] Length = 453 Score = 82.8 bits (203), Expect = 2e-16 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 EKEMKNKEDYYEV+EI+PGDGLMQKPDAFGCHLGDYT Sbjct: 417 EKEMKNKEDYYEVIEIVPGDGLMQKPDAFGCHLGDYT 453 >WP_069279780.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium elkanii] ODM72242.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium elkanii] ODM83239.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium elkanii] Length = 451 Score = 81.6 bits (200), Expect = 6e-16 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 E+EMKNKEDYYEV+EI+PGDGLMQKPDAFGCHLGDYT Sbjct: 415 EREMKNKEDYYEVIEIVPGDGLMQKPDAFGCHLGDYT 451 >WP_028337330.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium elkanii] Length = 451 Score = 80.9 bits (198), Expect = 1e-15 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 EKEMK+KEDYYEV+EI+PGDGLMQKPDAFGCHLGDYT Sbjct: 415 EKEMKDKEDYYEVIEIVPGDGLMQKPDAFGCHLGDYT 451 >WP_066508942.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium sp. BR 10303] KWV53066.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium sp. BR 10303] Length = 451 Score = 77.4 bits (189), Expect = 2e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 EKEMKNKEDYYEVVEI+PG+ LMQKPD FGCHLGDYT Sbjct: 415 EKEMKNKEDYYEVVEIVPGESLMQKPDEFGCHLGDYT 451 >WP_027533413.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium sp. WSM3983] Length = 444 Score = 76.3 bits (186), Expect = 5e-14 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 +K+MKNKED+Y+VVEI+PG+GLMQKPDAFGCHLGDYT Sbjct: 408 QKDMKNKEDWYDVVEIVPGEGLMQKPDAFGCHLGDYT 444 >WP_074116945.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium sp. AS23.2] OKO86528.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium sp. AS23.2] Length = 448 Score = 76.3 bits (186), Expect = 5e-14 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 +K+MKNKED+Y+VVEI+PG+GLMQKPDAFGCHLGDYT Sbjct: 412 QKDMKNKEDWYDVVEIVPGEGLMQKPDAFGCHLGDYT 448 >WP_063678627.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium neotropicale] OAF17224.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium neotropicale] Length = 448 Score = 76.3 bits (186), Expect = 5e-14 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 +K+MKNKED+Y+VVEI+PG+GLMQKPDAFGCHLGDYT Sbjct: 412 QKDMKNKEDWYDVVEIVPGEGLMQKPDAFGCHLGDYT 448 >WP_027553400.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium sp. Cp5.3] Length = 448 Score = 76.3 bits (186), Expect = 5e-14 Identities = 31/37 (83%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 +K+MKNKED+Y+VVEI+PG+GLMQKPDAFGCHLGDYT Sbjct: 412 QKDMKNKEDWYDVVEIVPGEGLMQKPDAFGCHLGDYT 448 >WP_027515131.1 branched-chain amino acid ABC transporter substrate-binding protein [Bradyrhizobium sp. WSM1417] Length = 444 Score = 74.7 bits (182), Expect = 2e-13 Identities = 30/37 (81%), Positives = 37/37 (100%) Frame = -3 Query: 320 EKEMKNKEDYYEVVEIIPGDGLMQKPDAFGCHLGDYT 210 +K+MKNKED+Y+VVEI+PG+GLMQKPDAFGCHLGDY+ Sbjct: 408 QKDMKNKEDWYDVVEIVPGEGLMQKPDAFGCHLGDYS 444