BLASTX nr result
ID: Glycyrrhiza28_contig00039715
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00039715 (374 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH12858.1 hypothetical protein GLYMA_15G199800 [Glycine max] 59 2e-07 >KRH12858.1 hypothetical protein GLYMA_15G199800 [Glycine max] Length = 525 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/53 (56%), Positives = 37/53 (69%) Frame = -3 Query: 372 RPCAAGEVSLDNASEVRDFL*F*KVNLYPGKSSLARYFLTPGGLCCLVWILIY 214 R CA GEVSLDNA+EVRD+L F KVNLYP SLAR+FL +++I+ Sbjct: 411 RSCADGEVSLDNAAEVRDYLRFLKVNLYPVNKSLARHFLAGPSFFFTFFLVIF 463