BLASTX nr result
ID: Glycyrrhiza28_contig00039608
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00039608 (338 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014628183.1 PREDICTED: coiled-coil domain-containing protein ... 54 3e-06 XP_014628182.1 PREDICTED: coiled-coil domain-containing protein ... 54 3e-06 XP_006606607.1 PREDICTED: coiled-coil domain-containing protein ... 54 3e-06 XP_006606606.1 PREDICTED: coiled-coil domain-containing protein ... 54 3e-06 XP_003556588.1 PREDICTED: coiled-coil domain-containing protein ... 54 3e-06 >XP_014628183.1 PREDICTED: coiled-coil domain-containing protein SCD2 isoform X5 [Glycine max] KRG93141.1 hypothetical protein GLYMA_20G250000 [Glycine max] Length = 420 Score = 54.3 bits (129), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 92 RTRRFPFDTGLGQPKDSGDQREASALRDEV 3 + +RFPFD GL QPKDSGDQREASALRDEV Sbjct: 39 KDKRFPFDAGLLQPKDSGDQREASALRDEV 68 >XP_014628182.1 PREDICTED: coiled-coil domain-containing protein SCD2 isoform X4 [Glycine max] Length = 428 Score = 54.3 bits (129), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 92 RTRRFPFDTGLGQPKDSGDQREASALRDEV 3 + +RFPFD GL QPKDSGDQREASALRDEV Sbjct: 146 KDKRFPFDAGLLQPKDSGDQREASALRDEV 175 >XP_006606607.1 PREDICTED: coiled-coil domain-containing protein SCD2 isoform X3 [Glycine max] Length = 458 Score = 54.3 bits (129), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 92 RTRRFPFDTGLGQPKDSGDQREASALRDEV 3 + +RFPFD GL QPKDSGDQREASALRDEV Sbjct: 146 KDKRFPFDAGLLQPKDSGDQREASALRDEV 175 >XP_006606606.1 PREDICTED: coiled-coil domain-containing protein SCD2 isoform X2 [Glycine max] KRG93142.1 hypothetical protein GLYMA_20G250000 [Glycine max] Length = 472 Score = 54.3 bits (129), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 92 RTRRFPFDTGLGQPKDSGDQREASALRDEV 3 + +RFPFD GL QPKDSGDQREASALRDEV Sbjct: 146 KDKRFPFDAGLLQPKDSGDQREASALRDEV 175 >XP_003556588.1 PREDICTED: coiled-coil domain-containing protein SCD2 isoform X1 [Glycine max] KRG93140.1 hypothetical protein GLYMA_20G250000 [Glycine max] Length = 527 Score = 54.3 bits (129), Expect = 3e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 92 RTRRFPFDTGLGQPKDSGDQREASALRDEV 3 + +RFPFD GL QPKDSGDQREASALRDEV Sbjct: 146 KDKRFPFDAGLLQPKDSGDQREASALRDEV 175