BLASTX nr result
ID: Glycyrrhiza28_contig00039555
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza28_contig00039555 (253 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SFL36504.1 Enoyl-[acyl-carrier-protein] reductase [NADH] [Methyl... 65 1e-10 WP_056243899.1 enoyl-[acyl-carrier-protein] reductase [Methyloba... 65 1e-10 ACS38294.1 Enoyl-[acyl-carrier-protein] reductase (NADH) [Methyl... 59 1e-08 BAU89146.1 enoyl-ACP reductase [Methylobacterium populi] 59 1e-08 WP_060768341.1 enoyl-[acyl-carrier-protein] reductase [Methyloba... 59 1e-08 WP_056195835.1 enoyl-[acyl-carrier-protein] reductase [Methyloba... 59 1e-08 WP_056457084.1 enoyl-[acyl-carrier-protein] reductase [Methyloba... 59 1e-08 WP_012605564.1 MULTISPECIES: enoyl-[acyl-carrier-protein] reduct... 59 1e-08 WP_003604003.1 enoyl-[acyl-carrier-protein] reductase [Methyloba... 59 1e-08 WP_026105253.1 enoyl-[acyl-carrier-protein] reductase [Methyloba... 59 1e-08 WP_012452432.1 enoyl-[acyl-carrier-protein] reductase [Methyloba... 59 1e-08 ABY28848.1 short-chain dehydrogenase/reductase SDR [Methylobacte... 59 2e-08 WP_066923190.1 enoyl-ACP reductase [Methylobacterium sp. CCH5-D2] 57 1e-07 WP_056178491.1 MULTISPECIES: enoyl-[acyl-carrier-protein] reduct... 57 1e-07 WP_056211878.1 MULTISPECIES: enoyl-[acyl-carrier-protein] reduct... 57 1e-07 WP_056471588.1 enoyl-[acyl-carrier-protein] reductase [Methyloba... 57 1e-07 WP_056350964.1 enoyl-[acyl-carrier-protein] reductase [Methyloba... 57 1e-07 WP_056277356.1 enoyl-[acyl-carrier-protein] reductase [Methyloba... 57 1e-07 SFL80121.1 Enoyl-[acyl-carrier-protein] reductase [NADH] [Methyl... 56 3e-07 SFD30345.1 Enoyl-[acyl-carrier-protein] reductase [NADH] [Methyl... 56 3e-07 >SFL36504.1 Enoyl-[acyl-carrier-protein] reductase [NADH] [Methylobacterium salsuginis] Length = 274 Score = 65.1 bits (157), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGDGEI 122 FVDSGYNIISMPRPAVLQAQDEAGVVGDGEI Sbjct: 244 FVDSGYNIISMPRPAVLQAQDEAGVVGDGEI 274 >WP_056243899.1 enoyl-[acyl-carrier-protein] reductase [Methylobacterium sp. Leaf456] KQT53342.1 enoyl-ACP reductase [Methylobacterium sp. Leaf456] Length = 278 Score = 65.1 bits (157), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGDGEI 122 FVDSGYNIISMPRPAVLQAQDEAGVVGDGEI Sbjct: 248 FVDSGYNIISMPRPAVLQAQDEAGVVGDGEI 278 >ACS38294.1 Enoyl-[acyl-carrier-protein] reductase (NADH) [Methylobacterium extorquens AM1] Length = 272 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRPAVLQAQDEAGVVGD Sbjct: 244 FVDSGYNIISMPRPAVLQAQDEAGVVGD 271 >BAU89146.1 enoyl-ACP reductase [Methylobacterium populi] Length = 273 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRPAVLQAQDEAGVVGD Sbjct: 244 FVDSGYNIISMPRPAVLQAQDEAGVVGD 271 >WP_060768341.1 enoyl-[acyl-carrier-protein] reductase [Methylobacterium sp. AMS5] AMB43584.1 enoyl-ACP reductase [Methylobacterium sp. AMS5] Length = 276 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRPAVLQAQDEAGVVGD Sbjct: 248 FVDSGYNIISMPRPAVLQAQDEAGVVGD 275 >WP_056195835.1 enoyl-[acyl-carrier-protein] reductase [Methylobacterium sp. Leaf123] KQQ27189.1 enoyl-ACP reductase [Methylobacterium sp. Leaf123] Length = 276 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRPAVLQAQDEAGVVGD Sbjct: 248 FVDSGYNIISMPRPAVLQAQDEAGVVGD 275 >WP_056457084.1 enoyl-[acyl-carrier-protein] reductase [Methylobacterium sp. Leaf90] KQO91834.1 enoyl-ACP reductase [Methylobacterium sp. Leaf90] Length = 276 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRPAVLQAQDEAGVVGD Sbjct: 248 FVDSGYNIISMPRPAVLQAQDEAGVVGD 275 >WP_012605564.1 MULTISPECIES: enoyl-[acyl-carrier-protein] reductase [Methylobacterium] ACK81396.1 short-chain dehydrogenase/reductase SDR [Methylobacterium extorquens CM4] CAX22156.1 Enoyl-[acyl-carrier-protein] reductase (NADH) [Methylobacterium extorquens DM4] KQO92524.1 enoyl-ACP reductase [Methylobacterium sp. Leaf92] KQP94452.1 enoyl-ACP reductase [Methylobacterium sp. Leaf119] KQQ01200.1 enoyl-ACP reductase [Methylobacterium sp. Leaf121] KQQ20401.1 enoyl-ACP reductase [Methylobacterium sp. Leaf122] OHV17284.1 enoyl-[acyl-carrier-protein] reductase [Methylobacterium extorquens] Length = 276 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRPAVLQAQDEAGVVGD Sbjct: 248 FVDSGYNIISMPRPAVLQAQDEAGVVGD 275 >WP_003604003.1 enoyl-[acyl-carrier-protein] reductase [Methylobacterium extorquens] EHP90357.1 Enoyl-(acyl-carrier-protein) reductase (NADH) [Methylobacterium extorquens DSM 13060] APX84186.1 enoyl-[acyl-carrier-protein] reductase [Methylobacterium extorquens] Length = 276 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRPAVLQAQDEAGVVGD Sbjct: 248 FVDSGYNIISMPRPAVLQAQDEAGVVGD 275 >WP_026105253.1 enoyl-[acyl-carrier-protein] reductase [Methylobacterium sp. MB200] Length = 277 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRPAVLQAQDEAGVVGD Sbjct: 248 FVDSGYNIISMPRPAVLQAQDEAGVVGD 275 >WP_012452432.1 enoyl-[acyl-carrier-protein] reductase [Methylobacterium populi] ACB78675.1 short-chain dehydrogenase/reductase SDR [Methylobacterium populi BJ001] OAH36399.1 enoyl-ACP reductase [Methylobacterium populi] Length = 277 Score = 59.3 bits (142), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRPAVLQAQDEAGVVGD Sbjct: 248 FVDSGYNIISMPRPAVLQAQDEAGVVGD 275 >ABY28848.1 short-chain dehydrogenase/reductase SDR [Methylobacterium extorquens PA1] Length = 291 Score = 59.3 bits (142), Expect = 2e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRPAVLQAQDEAGVVGD Sbjct: 263 FVDSGYNIISMPRPAVLQAQDEAGVVGD 290 >WP_066923190.1 enoyl-ACP reductase [Methylobacterium sp. CCH5-D2] Length = 276 Score = 57.0 bits (136), Expect = 1e-07 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRP VLQAQDEAGVVGD Sbjct: 248 FVDSGYNIISMPRPDVLQAQDEAGVVGD 275 >WP_056178491.1 MULTISPECIES: enoyl-[acyl-carrier-protein] reductase [Methylobacterium] KQP88050.1 enoyl-ACP reductase [Methylobacterium sp. Leaf117] KQP94672.1 enoyl-ACP reductase [Methylobacterium sp. Leaf113] Length = 277 Score = 56.6 bits (135), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRP VLQAQDEAGV+GD Sbjct: 248 FVDSGYNIISMPRPDVLQAQDEAGVIGD 275 >WP_056211878.1 MULTISPECIES: enoyl-[acyl-carrier-protein] reductase [Methylobacterium] KQP52345.1 enoyl-ACP reductase [Methylobacterium sp. Leaf111] KQT70141.1 enoyl-ACP reductase [Methylobacterium sp. Leaf465] KQU34041.1 enoyl-ACP reductase [Methylobacterium sp. Leaf94] Length = 277 Score = 56.6 bits (135), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRP VLQAQDEAGV+GD Sbjct: 248 FVDSGYNIISMPRPDVLQAQDEAGVIGD 275 >WP_056471588.1 enoyl-[acyl-carrier-protein] reductase [Methylobacterium sp. Leaf104] KQP38284.1 enoyl-ACP reductase [Methylobacterium sp. Leaf104] Length = 277 Score = 56.6 bits (135), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRP VLQAQDEAGV+GD Sbjct: 248 FVDSGYNIISMPRPDVLQAQDEAGVIGD 275 >WP_056350964.1 enoyl-[acyl-carrier-protein] reductase [Methylobacterium sp. Leaf89] KQO69338.1 enoyl-ACP reductase [Methylobacterium sp. Leaf89] Length = 277 Score = 56.6 bits (135), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRP VLQAQDEAGV+GD Sbjct: 248 FVDSGYNIISMPRPDVLQAQDEAGVIGD 275 >WP_056277356.1 enoyl-[acyl-carrier-protein] reductase [Methylobacterium sp. Leaf88] KQO63238.1 enoyl-ACP reductase [Methylobacterium sp. Leaf88] Length = 277 Score = 56.6 bits (135), Expect = 1e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVDSGYNIISMPRP VLQAQDEAGV+GD Sbjct: 248 FVDSGYNIISMPRPDVLQAQDEAGVIGD 275 >SFL80121.1 Enoyl-[acyl-carrier-protein] reductase [NADH] [Methylobacterium pseudosasicola] Length = 276 Score = 55.8 bits (133), Expect = 3e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVD+GYNIISMPRP VLQAQDEAGVVGD Sbjct: 248 FVDAGYNIISMPRPDVLQAQDEAGVVGD 275 >SFD30345.1 Enoyl-[acyl-carrier-protein] reductase [NADH] [Methylobacterium sp. 13MFTsu3.1M2] Length = 276 Score = 55.8 bits (133), Expect = 3e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +3 Query: 30 FVDSGYNIISMPRPAVLQAQDEAGVVGD 113 FVD+GYNIISMPRP VLQAQDEAGVVGD Sbjct: 248 FVDAGYNIISMPRPDVLQAQDEAGVVGD 275